Diaphorina citri psyllid: psy16407


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------6
MNDTLNPRSLLTNPDCRLFDSHYLVKYSHRRAGATFQGKVYNFLERPSGWKCFVYHFAV
ccccccccccccccccccccccEEEEEEEccccCEEEcEEEEEECcccccEEEEEEEEc
**********LTNPDCRLFDSHYLVKYSHRRAGATFQGKVYNFLERPSGWKCFVYHFAV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDTLNPRSLLTNPDCRLFDSHYLVKYSHRRAGATFQGKVYNFLERPSGWKCFVYHFAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium voltage-gated channel subfamily KQT member 1 Probably important in cardiac repolarization. Associates with KCNE1 (MinK) to form the I(Ks) cardiac potassium current. Elicits a rapidly activating, potassium-selective outward current. Muscarinic agonist oxotremorine-M strongly suppresses KCNQ1/KCNE1 current in CHO cells in which cloned KCNQ1/KCNE1 channels were coexpressed with M1 muscarinic receptors. May associate also with KCNE3 (MiRP2) to form the potassium channel that is important for cyclic AMP-stimulated intestinal secretion of chloride ions, which is reduced in cystic fibrosis and pathologically stimulated in cholera and other forms of secretory diarrhea.confidentP51787
Potassium voltage-gated channel subfamily KQT member 1 Probably important in cardiac repolarization. Associates with KCNE1 (MinK) to form the I(Ks) cardiac potassium current. Elicits a rapidly activating, potassium-selective outward current.confidentP97414
Potassium voltage-gated channel subfamily KQT member 1 Probably important in cardiac repolarization. Associates with KCNE1 (MinK) to form the I(Ks) cardiac potassium current. Elicits a rapidly activating, potassium-selective outward current.confidentQ9Z0N7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005251 [MF]delayed rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0005249, GO:0022839, GO:0022838, GO:0015079
GO:0071435 [BP]potassium ion exportprobableGO:0006810, GO:0071804, GO:0071805, GO:0006813, GO:0006812, GO:0006811, GO:0009987, GO:0015672, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0030001, GO:0051179, GO:0051234, GO:0055085, GO:0044699
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0060306 [BP]regulation of membrane repolarizationprobableGO:0042391, GO:0051049, GO:0050801, GO:0032844, GO:0042592, GO:0034765, GO:0050789, GO:0044699, GO:0065007, GO:0043269, GO:0065008, GO:0019725, GO:0009987, GO:0006873, GO:0050794, GO:0008150, GO:0055082, GO:0032879, GO:0048878, GO:2000021, GO:0044763, GO:0034762
GO:0042383 [CC]sarcolemmaprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0046676 [BP]negative regulation of insulin secretionprobableGO:0090087, GO:0051046, GO:0051048, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048519, GO:0051051, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046888, GO:0032879, GO:0090278, GO:0002791, GO:0002792, GO:0048523
GO:0015271 [MF]outward rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0005249, GO:0022839, GO:0022838, GO:0015079
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0042589 [CC]zymogen granule membraneprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0030667, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030141, GO:0030659, GO:0012505, GO:0012506, GO:0042588, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted