Diaphorina citri psyllid: psy16431


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MEKINKMEWWSKLVTTDPEINTKKINPEPSKLSDLDGETRGLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFMEQHPEMDFSNCKFG
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccc
*EKINKMEWWSKLVTTDPEINTKKINP**********ETRGLVEKM*************************FMEQHPEMDFSNCKF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKINKMEWWSKLVTTDPEINTKKINPEPSKLSDLDGETRGLVEKMMYDQRQKEMGLPTSDEQKKQDVLKKFMEQHPEMDFSNCKFG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear migration protein nudC Plays a role in neurogenesis and neuronal migration. Necessary for correct formation of mitotic spindles and chromosome separation during mitosis. Necessary for cytokinesis and cell proliferation.confidentQ5ZIN1
Nuclear migration protein nudC Plays a role in neurogenesis and neuronal migration. Necessary for correct formation of mitotic spindles and chromosome separation during mitosis.confidentQ63525
Nuclear migration protein nudC Plays a role in neurogenesis and neuronal migration. Necessary for correct formation of mitotic spindles and chromosome separation during mitosis.confidentO35685

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0042026 [BP]protein refoldingprobableGO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0000087 [BP]M phase of mitotic cell cycleprobableGO:0044699, GO:0000279, GO:0000278, GO:0009987, GO:0008150, GO:0044763, GO:0022403, GO:0022402, GO:0007049
GO:0040025 [BP]vulval developmentprobableGO:0032502, GO:0009791, GO:0048856, GO:0044707, GO:0048569, GO:0032501, GO:0002119, GO:0044767, GO:0048513, GO:0002164, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0043434 [BP]response to peptide hormone stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048489 [BP]synaptic vesicle transportprobableGO:0019226, GO:0035637, GO:0051649, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0097480, GO:0097479, GO:0051641, GO:0032501, GO:0050877, GO:0006810, GO:0044765, GO:0008150, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051640, GO:0003008, GO:0044700, GO:0016192, GO:0044707, GO:0044763, GO:0009987
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0000236 [BP]mitotic prometaphaseprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007067, GO:0007049, GO:0022403
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0035046 [BP]pronuclear migrationprobableGO:0044699, GO:0051656, GO:0000003, GO:0051234, GO:0040023, GO:0009987, GO:0009566, GO:0019953, GO:0008150, GO:0022414, GO:0044702, GO:0044763, GO:0007338, GO:0051649, GO:0051647, GO:0007097, GO:0051179, GO:0051640, GO:0051641
GO:0035047 [BP]centrosomal and pronuclear rotationprobableGO:0032502, GO:0048610, GO:0000003, GO:0022414, GO:0048869, GO:0009987, GO:0009566, GO:0019953, GO:0003006, GO:0044702, GO:0044763, GO:0007338, GO:0008150, GO:0044699
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WFI, chain A
Confidence level:very confident
Coverage over the Query: 1-48
View the alignment between query and template
View the model in PyMOL
Template: 2RH0, chain A
Confidence level:confident
Coverage over the Query: 1-21,37-48,61-82
View the alignment between query and template
View the model in PyMOL