Diaphorina citri psyllid: psy16434


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-----
MLPRETESYLTTCRIPSPELASDGQNYQTYGIEKYFTRNQTYQCLVCKNKTLFHDLAEGARHVERHHWDQPDKNSLFVISDRFLCNLCGNEYKFRNFIIGRATSNDTIGTNRTRIACSLYPTDSYVTCAGMMATVPYTGITLLKVVREIRRRGAFRTVYPTIPSPRRTTLPAAIFQYYDKHFSGLEEAVYRNISACKDFADTVRTAYGPNGMNKIVINHIDKLFVTNDAATIIRELEIEHPAAKLIILGSQMQEEEMGDGTNFVIIFAGALLVNADNLLRMIEHPAAKLIILGSQMQEEEMGDGTNFVIIFAGALLVNADNLLRMGLTPSEIVNGYKLALAKTLEILPTLTCFEVKDVRNVENVTKGIKSAIMSKQYGNEDFLTDLITKACVSILPDGSSSFNVDNVRITKILGSGLFNSEIVQGMVFKRSVEGDITKQTKAKIAVYTCPVDIATTETKTPPAASELGYADSVAVDELGDTAVVVFKLEAAESRIATLVIRGATENYMDDIERAVDDGVNTFKGITKVFVKTLAENTGVKSNEVISKLYSAHNEGKKTYGFDINGENSSVIDAAEAGILDLYLTKMWALKYATSAANTILQQTKAKIAVYTCPVDIATTETKGTVLIKSADELMKFSRGEENQLEEQIKAIADTGANVVVAGAKFGDMALHYLNKYGLMGVRLNSKFDLRRLCKAVNATALPRLVSTYIKMPSFCPAPPVQGRERDRPAQTCKYLHQNALDPDDD
cccccccccccccccccccccccccccCEEccEEEEEcccEEEEEEEccccHHHHHHHHHHHHHHccccccccccEEEEEccHHHccccccccccEEEEEEccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEccHHHHHHHHHccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccCEEEEEEcccccccccEEEEEEEEccccccccccccccEEEECccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccEEccccccccccccEEEEEEEEccccccHHccccccEEEEEccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHcccEEEECccHHHHHHHHHHHccEEccccccccccccccccccccccccccccccccEEEECcccccccc
******ESYLTTCRIPSPELASDGQNYQTYGIEKYFTRNQTYQCLVCKNKTLFHDLAEGARHVERHHWDQPDKNSLFVISDRFLCNLCGNEYKFRNFIIGRATSNDTIGTNRTRIACSLYPTDSYVTCAGMMATVPYTGITLLKVVREIRRRGAFRTVYPTIPSPRRTTLPAAIFQYYDKHFSGLEEAVYRNISACKDFADTVRTAYGPNGMNKIVINHIDKLFVTNDAATIIRELEIEHPAAKLIILGSQMQEEEMGDGTNFVIIFAGALLVNADNLLRMIEHPAAKLIILGSQMQEEEMGDGTNFVIIFAGALLVNADNLLRMGLTPSEIVNGYKLALAKTLEILPTLTCFEVKDVRNVENVTKGIKSAIMSKQYGNEDFLTDLITKACVSILPDGSSSFNVDNVRITKILGSGLFNSEIVQGMVFKRSVEGDITKQTKAKIAVYTCPVDIATTETKTPPAASELGYADSVAVDELGDTAVVVFKLEAAESRIATLVIRGATENYMDDIERAVDDGVNTFKGITKVFVKTLAENTGVKSNEVISKLYSAHNEGKKTYGFDINGENSSVIDAAEAGILDLYLTKMWALKYATSAANTILQQTKAKIAVYTCPVDIATTETKGTVLIKSADELMKFSRGEENQLEEQIKAIADTGANVVVAGAKFGDMALHYLNKYGLMGVRLNSKFDLRRLCKAVNATALPRLVSTYIKMPSFCPAPPVQ*****RPAQTCKYL***A******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPRETESYLTTCRIPSPELASDGQNYQTYGIEKYFTRNQTYQCLVCKNKTLFHDLAEGARHVERHHWDQPDKNSLFVISDRFLCNLCGNEYKFRNFIIGRATSNDTIGTNRTRIACSLYPTDSYVTCAGMMATVPYTGITLLKVVREIRRRGAFRTVYPTIPSPRRTTLPAAIFQYYDKHFSGLEEAVYRNISACKDFADTVRTAYGPNGMNKIVINHIDKLFVTNDAATIIRELEIEHPAAKLIILGSQMQEEEMGDGTNFVIIFAGALLVNADNLLRMIEHPAAKLIILGSQMQEEEMGDGTNFVIIFAGALLVNADNLLRMGLTPSEIVNGYKLALAKTLEILPTLTCFEVKDVRNVENVTKGIKSAIMSKQYGNEDFLTDLITKACVSILPDGSSSFNVDNVRITKILGSGLFNSEIVQGMVFKRSVEGDITKQTKAKIAVYTCPVDIATTETKTPPAASELGYADSVAVDELGDTAVVVFKLEAAESRIATLVIRGATENYMDDIERAVDDGVNTFKGITKVFVKTLAENTGVKSNEVISKLYSAHNEGKKTYGFDINGENSSVIDAAEAGILDLYLTKMWALKYATSAANTILQQTKAKIAVYTCPVDIATTETKGTVLxxxxxxxxxxxxxxxxxxxxxIKAIADTGANVVVAGAKFGDMALHYLNKYGLMGVRLNSKFDLRRLCKAVNATALPRLVSTYIKMPSFCPAPPVQGRERDRPAQTCKYLHQNALDPDDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
T-complex protein 1 subunit theta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.confidentQ6EE31
T-complex protein 1 subunit theta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.confidentP42932
T-complex protein 1 subunit theta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.confidentQ3ZCI9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P9D, chain H
Confidence level:very confident
Coverage over the Query: 172-260,305-599
View the alignment between query and template
View the model in PyMOL
Template: 3IYG, chain A
Confidence level:very confident
Coverage over the Query: 460-732
View the alignment between query and template
View the model in PyMOL
Template: 3LOS, chain A
Confidence level:confident
Coverage over the Query: 164-239,284-458
View the alignment between query and template
View the model in PyMOL
Template: 1Q3S, chain A
Confidence level:confident
Coverage over the Query: 173-285,330-458
View the alignment between query and template
View the model in PyMOL
Template: 1X6E, chain A
Confidence level:probable
Coverage over the Query: 37-71,83-95
View the alignment between query and template
View the model in PyMOL