Diaphorina citri psyllid: psy16463


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MTSAQVPQGQQSPNMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRREQEAVETSVKHDEAVSTEKTQQSETPVAPKKRQRKKNTEVDSEMIECSSTPLPRSSATIAVVKKPSTQSGGKKKKRKTKQQRECEKEATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARSNAVRPKKQLVERLEKYNKEKQEKIGNMSK
cccccccccccccccccHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccEEECcccccccccEEccccccccccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHccccc
*****************QAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRR*******************************************************************************************PDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRK********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSAQVPQGQQSPNMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRREQEAVETSVKHDEAVSTEKTQQSETPVAPKKRQRKKNTEVDSEMIECSSTPLPRSSATIAVVKKPSTQSGGKKKKRKTKQQRECEKEATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARSNAVRPxxxxxxxxxxxxxxxxxxxxxMSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inhibitor of growth protein 1 Isoform 1 inhibits p53-dependent transcriptional activation and may function as an oncoprotein. Isoform 2 acts as a negative growth regulator by cooperating with p53 in transcriptional activation of p53-responsive genes and may act as a tumor suppressor.confidentQ9QXV3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0016568 [BP]chromatin modificationprobableGO:0006996, GO:0051276, GO:0006325, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0006606 [BP]protein import into nucleusprobableGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0016482, GO:0017038, GO:0034613, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0035064 [MF]methylated histone residue bindingprobableGO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0044451 [CC]nucleoplasm partprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0010941 [BP]regulation of cell deathprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AFL, chain A
Confidence level:very confident
Coverage over the Query: 29-124
View the alignment between query and template
View the model in PyMOL
Template: 1WEU, chain A
Confidence level:very confident
Coverage over the Query: 222-289
View the alignment between query and template
View the model in PyMOL
Template: 3ZTG, chain A
Confidence level:probable
Coverage over the Query: 236-311
View the alignment between query and template
View the model in PyMOL