Psyllid ID: psy16463

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MTSAQVPQGQQSPNMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRREQEAVETSVKHDEAVSTEKTQQSETPVAPKKRQRKKNTEVDSEMIECSSTPLPRSSATIAVVKKPSTQSGGKKKKRKTKQQRECEKEATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARSNAVRPKKQLVERLEKYNKEKQEKIGNMSK
cccccccccccccccccHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccEEEEcccccccccEEcccccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHccccc
ccccccccccccHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEcccEEEcccccccEEEEEEcEccccccccccEccccccccccccccccHHHHHHHHHHHHHHHHHcccccc
mtsaqvpqgqqspnMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIAsqngnkidqfsrKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKtrqidgifynlpsvtsrrEQEAVETSVKhdeavstektqqsetpvapkkrqrkkntevdsemiecsstplprssatiavvkkpstqsggkkkkrktKQQRecekeatpppdedlaidpneptyclcnqvsfgqmvmcdndlcphqwfhfscvavtntpkgkwycpncrkarsnavrpkKQLVERLEKYNKEKQEKIGNMSK
mtsaqvpqgqqspnMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIasqngnkidqfsRKRNLLRVQVALIAAqeigdeklSIMQQVQDVIEGKTRQIDGIFynlpsvtsrrEQEAVETSvkhdeavstektqqsetpvapkkrqrkkntevdsemiecsstplprssatiavvkkpstqsggkkkkrktkqqrecekeatpppdedlaidPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKwycpncrkarsnavrpkkqlverlekynkekqekignmsk
MTSAQVPQGQQSPNMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRREQEAVETSVKHDEAVSTEKTQQSETPVAPKKRQRKKNTEVDSEMIECSSTPLPRSSATIAVVKKPstqsggkkkkrktkqqrECEKEATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARSNAVRPKKQLVERLEKYNKEKQEKIGNMSK
*****************QAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLP************************************************************************************************************PTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRK********************************
************************YSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKE********************************EIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRREQEAVETSVKHDEAVST**************************************************************************PDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCP************************************
***********SPNMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSV*******************************************************LPRSSATIAV******************************PDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARSNAVRPKKQLVERLEKYNKE**********
************PNMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRR**********************************************************************************************DLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKA********************E**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSAQVPQGQQSPNMLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGNKIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRREQEAVETSVKHDEAVSTEKTQQSETPVAPKKRQRKKNTEVDSEMIECSSTPLPRSSATIAVVKKPSTQSGGKKKKRKTKQQRECEKEATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARSNAVRPxxxxxxxxxxxxxxxxxxxxxMSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query317 2.2.26 [Sep-21-2011]
Q9QXV3279 Inhibitor of growth prote yes N/A 0.867 0.985 0.377 1e-44
Q9H160280 Inhibitor of growth prote no N/A 0.791 0.896 0.358 1e-38
Q9ESK4281 Inhibitor of growth prote no N/A 0.735 0.829 0.382 1e-38
Q9UK53422 Inhibitor of growth prote no N/A 0.706 0.530 0.366 2e-33
Q8C0D7249 Inhibitor of growth prote no N/A 0.766 0.975 0.307 1e-32
Q9UNL4249 Inhibitor of growth prote no N/A 0.766 0.975 0.295 2e-32
Q5ZKY4249 Inhibitor of growth prote no N/A 0.766 0.975 0.292 6e-32
Q9D8Y8240 Inhibitor of growth prote no N/A 0.716 0.945 0.309 3e-30
Q3T095248 Inhibitor of growth prote no N/A 0.763 0.975 0.307 5e-30
Q8WYH8240 Inhibitor of growth prote no N/A 0.681 0.9 0.297 8e-29
>sp|Q9QXV3|ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus GN=Ing1 PE=2 SV=1 Back     alignment and function desciption
 Score =  180 bits (457), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 168/294 (57%), Gaps = 19/294 (6%)

Query: 15  MLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGN 74
           ML+ A  E ++ V YVE YLD +E+LP ++QR ++ +RE+D  YQ  +KE++    +   
Sbjct: 1   MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKR 60

Query: 75  KIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRR 134
           + D   ++R L  +Q ALI +QE+GDEK+ I+ Q+ +++E ++RQ+D       +     
Sbjct: 61  ETDGTQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDIS 120

Query: 135 EQEAVETSVKHDEAVSTEKTQQSETPVAPKKRQRKKNTEVDSEMIECSSTPLPRSSATIA 194
           +          D++ S E   Q++ P   + R+++ N     E  E +S        T  
Sbjct: 121 DGTGGSGKAGQDKSKS-EAITQADKPNNKRSRRQRNN-----ENRENASNNHDHDDITSG 174

Query: 195 VVKKPSTQSGGKKKKRKTKQQRECEKEATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCD 254
             K+   ++  KKK+ K K +RE    A+P    DL IDPNEPTYCLCNQVS+G+M+ CD
Sbjct: 175 TPKEKKAKTSKKKKRSKAKAERE----ASPA---DLPIDPNEPTYCLCNQVSYGEMIGCD 227

Query: 255 NDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARSNAVRPKKQLVERLEKYNKEK 308
           ND CP +WFHFSCV + + PKGKWYCP CR         +K + + LEK  KE+
Sbjct: 228 NDECPIEWFHFSCVGLNHKPKGKWYCPKCRG------ESEKTMDKALEKSKKER 275
Isoform 1 inhibits p53-dependent transcriptional activation and may function as an oncoprotein. Isoform 2 acts as a negative growth regulator by cooperating with p53 in transcriptional activation of p53-responsive genes and may act as a tumor suppressor.
Mus musculus (taxid: 10090)
>sp|Q9H160|ING2_HUMAN Inhibitor of growth protein 2 OS=Homo sapiens GN=ING2 PE=1 SV=2 Back     alignment and function description
>sp|Q9ESK4|ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus GN=Ing2 PE=1 SV=3 Back     alignment and function description
>sp|Q9UK53|ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens GN=ING1 PE=1 SV=2 Back     alignment and function description
>sp|Q8C0D7|ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus GN=Ing4 PE=1 SV=2 Back     alignment and function description
>sp|Q9UNL4|ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens GN=ING4 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZKY4|ING4_CHICK Inhibitor of growth protein 4 OS=Gallus gallus GN=ING4 PE=2 SV=1 Back     alignment and function description
>sp|Q9D8Y8|ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus GN=Ing5 PE=1 SV=1 Back     alignment and function description
>sp|Q3T095|ING4_BOVIN Inhibitor of growth protein 4 OS=Bos taurus GN=ING4 PE=2 SV=1 Back     alignment and function description
>sp|Q8WYH8|ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens GN=ING5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
383847599304 PREDICTED: inhibitor of growth protein 1 0.921 0.960 0.487 7e-78
307196441305 Inhibitor of growth protein 1 [Harpegnat 0.921 0.957 0.472 9e-78
332024248306 Inhibitor of growth protein 1 [Acromyrme 0.921 0.954 0.474 7e-75
307186888304 Inhibitor of growth protein 1 [Camponotu 0.924 0.963 0.456 4e-72
380011211305 PREDICTED: inhibitor of growth protein 1 0.917 0.954 0.458 6e-72
328779799305 PREDICTED: inhibitor of growth protein 1 0.914 0.950 0.456 7e-72
345489057306 PREDICTED: LOW QUALITY PROTEIN: inhibito 0.911 0.944 0.466 1e-71
340713037305 PREDICTED: inhibitor of growth protein 1 0.930 0.967 0.464 4e-71
242020340330 conserved hypothetical protein [Pediculu 0.946 0.909 0.429 1e-70
350419688305 PREDICTED: inhibitor of growth protein 1 0.930 0.967 0.464 1e-70
>gi|383847599|ref|XP_003699440.1| PREDICTED: inhibitor of growth protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  296 bits (759), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 150/308 (48%), Positives = 212/308 (68%), Gaps = 16/308 (5%)

Query: 15  MLNQAVLEAMYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGN 74
           MLNQAV+EA+YS  Y+E YLD VENLP+++QR+++++RELD   Q+Y++E++       N
Sbjct: 1   MLNQAVVEALYSATYIENYLDCVENLPNDLQRHVSRLRELDATCQTYLREVDQQQEALRN 60

Query: 75  KIDQFSRKRNLLRVQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRR 134
             D   ++R LLRVQ ALIAAQEIGDEKL I+QQVQD+IE K+RQ+D  + NL      +
Sbjct: 61  DTDLAVKRRALLRVQQALIAAQEIGDEKLQIVQQVQDLIENKSRQLDLDYRNL---DFGK 117

Query: 135 EQEAVETSVKHDEAVSTEKTQQSETPVAPKKRQRKKNTEVDSE--------MIECSSTPL 186
           EQE  E++ + +  V++  +  +       KR R+  TE   E        M E  S  L
Sbjct: 118 EQETNESARETNANVNSNASGNANNSERQPKRARRTRTETMVESNAMDMIVMTETRSNSL 177

Query: 187 PRSSATIAVVKKPSTQSGGKKKKRKTKQ---QRECEKEATPPPDEDLAIDPNEPTYCLCN 243
             S+A+    KK +T + GKKKKRK++Q   Q +  ++  PPP++DLAIDP+EPTYCLC+
Sbjct: 178 --SNASNGNQKKTTTANTGKKKKRKSRQGSQQNQHREDTPPPPEDDLAIDPDEPTYCLCD 235

Query: 244 QVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARSNAVRPKKQLVERLEK 303
           Q+S+G+M++CDNDLCP +WFHFSCV+++  PKGKW+CP CR  R N ++PK Q ++ LE+
Sbjct: 236 QISYGEMILCDNDLCPIEWFHFSCVSLSTKPKGKWFCPKCRGDRPNVMKPKAQFLKELER 295

Query: 304 YNKEKQEK 311
           YNKEK+EK
Sbjct: 296 YNKEKEEK 303

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307196441|gb|EFN78019.1| Inhibitor of growth protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332024248|gb|EGI64452.1| Inhibitor of growth protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307186888|gb|EFN72289.1| Inhibitor of growth protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380011211|ref|XP_003689704.1| PREDICTED: inhibitor of growth protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|328779799|ref|XP_394517.4| PREDICTED: inhibitor of growth protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|345489057|ref|XP_003426042.1| PREDICTED: LOW QUALITY PROTEIN: inhibitor of growth protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340713037|ref|XP_003395058.1| PREDICTED: inhibitor of growth protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|242020340|ref|XP_002430613.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515785|gb|EEB17875.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350419688|ref|XP_003492269.1| PREDICTED: inhibitor of growth protein 1-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
FB|FBgn0038546433 CG7379 [Drosophila melanogaste 0.280 0.205 0.630 5.4e-57
UNIPROTKB|E2R8X6279 ING1 "Uncharacterized protein" 0.867 0.985 0.357 2.3e-46
UNIPROTKB|J9NYI4279 LOC478381 "Uncharacterized pro 0.867 0.985 0.350 1.2e-44
MGI|MGI:1349481279 Ing1 "inhibitor of growth fami 0.867 0.985 0.360 2.4e-44
ZFIN|ZDB-GENE-040718-147278 ing2 "inhibitor of growth fami 0.788 0.899 0.378 2.4e-44
UNIPROTKB|G3MY31283 ING2 "Uncharacterized protein" 0.264 0.296 0.548 5.9e-44
UNIPROTKB|Q9H160280 ING2 "Inhibitor of growth prot 0.264 0.3 0.537 9.6e-44
UNIPROTKB|E2QX70282 ING2 "Uncharacterized protein" 0.198 0.223 0.681 2e-43
ZFIN|ZDB-GENE-060421-4388309 ing1 "inhibitor of growth fami 0.867 0.889 0.336 6.8e-40
UNIPROTKB|F1P2P2235 ING1 "Uncharacterized protein" 0.716 0.965 0.362 9.2e-36
FB|FBgn0038546 CG7379 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 5.4e-57, Sum P(2) = 5.4e-57
 Identities = 58/92 (63%), Positives = 76/92 (82%)

Query:   220 KEATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWY 279
             +E TPPP+    IDP+EPTYC+CNQ+SFG+M++CDNDLCP +WFHFSCV++   PKGKW+
Sbjct:   344 REETPPPE---TIDPDEPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLKPKGKWF 400

Query:   280 CPNCRKARSNAVRPKKQLVERLEKYNKEKQEK 311
             CPNCR  R N ++PK Q ++ LE+YNKEK+EK
Sbjct:   401 CPNCRGERPNVMKPKAQFLKELERYNKEKEEK 432
GO:0008270 "zinc ion binding" evidence=IEA
GO:0070822 "Sin3-type complex" evidence=IDA
UNIPROTKB|E2R8X6 ING1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYI4 LOC478381 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1349481 Ing1 "inhibitor of growth family, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-147 ing2 "inhibitor of growth family, member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3MY31 ING2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H160 ING2 "Inhibitor of growth protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QX70 ING2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060421-4388 ing1 "inhibitor of growth family, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2P2 ING1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9QXV3ING1_MOUSENo assigned EC number0.37750.86750.9856yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
COG5034271 COG5034, TNG2, Chromatin remodeling protein, conta 5e-24
pfam12998104 pfam12998, ING, Inhibitor of growth proteins N-ter 3e-21
pfam0062851 pfam00628, PHD, PHD-finger 1e-07
smart0024947 smart00249, PHD, PHD zinc finger 4e-07
>gnl|CDD|227367 COG5034, TNG2, Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information 
 Score = 98.5 bits (245), Expect = 5e-24
 Identities = 71/283 (25%), Positives = 105/283 (37%), Gaps = 41/283 (14%)

Query: 28  PYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIE-----HIASQNGNKIDQFSRK 82
           P +    D + N+P E     T++ E+D      +K +           + +       +
Sbjct: 5   PGLNDITDHLANVPSETDIRFTELSEIDAKVCDIIKNLRQMISILKKIIDLDSQTYEEVE 64

Query: 83  RNLLR-VQVALIAAQEIGDEKLSIMQQVQDVIEGKTRQIDGIFY------------NLPS 129
             LL+ ++  L+ A  I  EK  +  + + ++    + +D                N   
Sbjct: 65  DGLLKEIRELLLKAIYIQKEKSDLADRAEKLLRRHRKLLDDRIAKRPHEKVAARIENCHD 124

Query: 130 VTSRRE--QEAVETSVKHDEAVSTEKTQQSETPVAPKK---RQRKKNTEVDSEMIECSST 184
             SR E    +        E  S   +Q S      K+      K+ +   S   E S T
Sbjct: 125 AVSRLERNSYSSAARRSSGEHRSAASSQGSRHTKLKKRKNIHNLKRRSPELSSKREVSFT 184

Query: 185 PLPRSS-ATIAVVKKPSTQSGGKKKKRKTKQQRECEKEATPPPDEDLAIDPNEPTYCLCN 243
               S   T   VK+    +GG  K R    +   E                E  YC C 
Sbjct: 185 LESPSVPDTATRVKE--GNNGGSTKSRGVSSEDNSE---------------GEELYCFCQ 227

Query: 244 QVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKA 286
           QVS+GQMV CDN  C  +WFH  CV +   PKGKWYCP C+KA
Sbjct: 228 QVSYGQMVACDNANCKREWFHLECVGLKEPPKGKWYCPECKKA 270

Length = 271
>gnl|CDD|221887 pfam12998, ING, Inhibitor of growth proteins N-terminal histone-binding Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 100.0
KOG1973|consensus274 100.0
PF12998105 ING: Inhibitor of growth proteins N-terminal histo 99.92
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.85
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.69
KOG1512|consensus381 97.69
KOG4299|consensus 613 97.64
KOG0825|consensus 1134 97.57
KOG4323|consensus 464 97.54
KOG0954|consensus 893 97.46
KOG0956|consensus 900 97.19
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.11
KOG0383|consensus 696 96.9
KOG1244|consensus336 96.67
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 96.64
KOG1245|consensus 1404 96.51
KOG0955|consensus 1051 96.49
KOG1632|consensus 345 95.95
COG5141 669 PHD zinc finger-containing protein [General functi 95.0
KOG1844|consensus 508 94.87
KOG1632|consensus345 93.88
KOG0957|consensus 707 92.7
KOG0957|consensus707 92.67
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 88.4
KOG2752|consensus 345 88.21
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 87.84
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 86.89
KOG1473|consensus 1414 82.85
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-37  Score=281.22  Aligned_cols=249  Identities=23%  Similarity=0.426  Sum_probs=150.4

Q ss_pred             hhhhHHHHHHHHHhhcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHhCcCC----hHHHHHHHHHHHHHHHHHHH
Q psy16463         24 MYSVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIAS--QNGNKID----QFSRKRNLLRVQVALIAAQE   97 (317)
Q Consensus        24 ~~~a~yLedyld~ienLP~Elqr~l~lIRElD~k~~~~~~~ie~~~~--~~~k~~~----~~~~~~~~~~I~~~l~~a~e   97 (317)
                      +++++.|+||+|.|+|+|.|+.++|++|.++|.++.++++.|.+.+.  +|....+    .+....+...|++.|-.++.
T Consensus         1 ~d~~~~Lnd~~d~l~n~P~et~~~~t~l~~iD~k~~d~~k~l~q~~si~k~~~~~~~~t~~e~ed~l~k~i~Ell~~a~~   80 (271)
T COG5034           1 ADLFPGLNDITDHLANVPSETDIRFTELSEIDAKVCDIIKNLRQMISILKKIIDLDSQTYEEVEDGLLKEIRELLLKAIY   80 (271)
T ss_pred             CchhHHHHHHHHHHHhCChhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHhhcccCccccchhHHHHHHHHHHHHHHH
Confidence            46789999999999999999999999999999999999999887765  3322222    23345688889999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhHhccCcCcccchhhh---hhhccccccccc---ccc-------cccCCCCCCCcc
Q psy16463         98 IGDEKLSIMQQVQDVIEGKTRQIDGIFYNLPSVTSRREQE---AVETSVKHDEAV---STE-------KTQQSETPVAPK  164 (317)
Q Consensus        98 l~dEKv~LA~q~~dlVdkhirrLD~dl~~le~d~~~~e~~---~~~~~~~~~~~s---~~~-------~~~~~~~~~~~k  164 (317)
                      ++.+|+.||+.+..+++||+++||..+.+...++.....+   .........+.+   +++       .+.++.-+...+
T Consensus        81 ~~~~~~~l~d~~~~l~~Rh~~~~d~~~a~~~h~~~~~~ie~~~~~~s~~~~~~~ss~a~~ss~~~~saassqgs~~t~~~  160 (271)
T COG5034          81 IQKEKSDLADRAEKLLRRHRKLLDDRIAKRPHEKVAARIENCHDAVSRLERNSYSSAARRSSGEHRSAASSQGSRHTKLK  160 (271)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhHHHhhhhhhhhhhhhhhhhhhhhhhccccchhhhccccccccccccccccCchhH
Confidence            9999999999999999999999999998887543221111   000000000001   000       000000000000


Q ss_pred             ccccccCcccccchhccCCCCCCCCCccccccCCCCCCCCCcccccccchhhcccccC-CCC-CCCCCCCCCCCCceeee
Q psy16463        165 KRQRKKNTEVDSEMIECSSTPLPRSSATIAVVKKPSTQSGGKKKKRKTKQQRECEKEA-TPP-PDEDLAIDPNEPTYCLC  242 (317)
Q Consensus       165 r~rr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~k~~~~~~~~~~~~~-~~~-~~~~~~~d~~e~~~C~C  242 (317)
                       .|....+...       .++...+....+....+.+  ..+...+..    ....+. .+. .-...+..+++.+||+|
T Consensus       161 -~R~n~~~~k~-------~~p~~~S~r~~~~t~~sp~--v~~t~t~v~----e~~~~~s~~~~~vss~d~se~e~lYCfC  226 (271)
T COG5034         161 -KRKNIHNLKR-------RSPELSSKREVSFTLESPS--VPDTATRVK----EGNNGGSTKSRGVSSEDNSEGEELYCFC  226 (271)
T ss_pred             -HHHhhccccc-------CCcchhhhccCCccCCCCC--cccchhhhh----cccCCCCccccCcCccccccCceeEEEe
Confidence             0000000000       0000000000000000000  000000000    000000 000 00111344678899999


Q ss_pred             CCCCCCCeeeeCCCCCCCcceecccCCccCCCCCceeCcccccc
Q psy16463        243 NQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKA  286 (317)
Q Consensus       243 ~~~~~g~mi~Cd~~~C~~~wfH~~Cvgl~~~p~~~w~C~~C~~~  286 (317)
                      ++|+||+||+|||++|.++|||+.||||..+|+|+||||+|...
T Consensus       227 qqvSyGqMVaCDn~nCkrEWFH~~CVGLk~pPKG~WYC~eCk~~  270 (271)
T COG5034         227 QQVSYGQMVACDNANCKREWFHLECVGLKEPPKGKWYCPECKKA  270 (271)
T ss_pred             cccccccceecCCCCCchhheeccccccCCCCCCcEeCHHhHhc
Confidence            99999999999999999999999999999999999999999753

>KOG1973|consensus Back     alignment and domain information
>PF12998 ING: Inhibitor of growth proteins N-terminal histone-binding; InterPro: IPR024610 Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG0954|consensus Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG1244|consensus Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG1844|consensus Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>KOG2752|consensus Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
1wes_A71 Solution Structure Of Phd Domain In Inhibitor Of Gr 2e-24
2qic_A62 Crystal Structure Of The Ing1 Phd Finger In Complex 3e-24
2g6q_A62 Crystal Structure Of Ing2 Phd Domain In Complex Wit 1e-23
1wen_A71 Solution Structure Of Phd Domain In Ing1-Like Prote 9e-21
2vnf_A60 Molecular Basis Of Histone H3k4me3 Recognition By I 1e-20
1weu_A91 Solution Structure Of Phd Domain In Ing1-Like Prote 2e-20
2m1r_A63 Phd Domain Of Ing4 N214d Mutant Length = 63 9e-20
2k1j_A63 Plan Homeodomain Finger Of Tumour Supressor Ing4 Le 1e-19
3c6w_A59 Crystal Structure Of The Ing5 Phd Finger In Complex 2e-18
2pnx_A55 The Phd Finger Of Ing4 In Complex With An H3k4me3 H 2e-18
1x4i_A70 Solution Structure Of Phd Domain In Inhibitor Of Gr 8e-18
2jmi_A90 Nmr Solution Structure Of Phd Finger Fragment Of Ye 2e-13
4afl_A104 The Crystal Structure Of The Ing4 Dimerization Doma 3e-06
>pdb|1WES|A Chain A, Solution Structure Of Phd Domain In Inhibitor Of Growth Family, Member 1-Like Length = 71 Back     alignment and structure 
Iteration: 1

 Score =  109 bits (272), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 49/56 (87%)
Query: 229 DLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCR 284
           + AIDPNEPTYCLCNQVS+G+M+ CDN+ CP +WFHFSCV++T  PKGKWYCP CR
Sbjct: 8   EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCR 63
>pdb|2QIC|A Chain A, Crystal Structure Of The Ing1 Phd Finger In Complex With A Histone H3k4me3 Peptide Length = 62 Back     alignment and structure
>pdb|2G6Q|A Chain A, Crystal Structure Of Ing2 Phd Domain In Complex With H3k4me3 Peptide Length = 62 Back     alignment and structure
>pdb|1WEN|A Chain A, Solution Structure Of Phd Domain In Ing1-Like Protein Bac25079 Length = 71 Back     alignment and structure
>pdb|2VNF|A Chain A, Molecular Basis Of Histone H3k4me3 Recognition By Ing4 Length = 60 Back     alignment and structure
>pdb|1WEU|A Chain A, Solution Structure Of Phd Domain In Ing1-Like Protein Bac25009 Length = 91 Back     alignment and structure
>pdb|2M1R|A Chain A, Phd Domain Of Ing4 N214d Mutant Length = 63 Back     alignment and structure
>pdb|2K1J|A Chain A, Plan Homeodomain Finger Of Tumour Supressor Ing4 Length = 63 Back     alignment and structure
>pdb|3C6W|A Chain A, Crystal Structure Of The Ing5 Phd Finger In Complex With H3k4me3 Peptide Length = 59 Back     alignment and structure
>pdb|2PNX|A Chain A, The Phd Finger Of Ing4 In Complex With An H3k4me3 Histone Peptide Length = 55 Back     alignment and structure
>pdb|1X4I|A Chain A, Solution Structure Of Phd Domain In Inhibitor Of Growth Protein 3 (Ing3) Length = 70 Back     alignment and structure
>pdb|2JMI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Yeast Yng1 Protein In Free State Length = 90 Back     alignment and structure
>pdb|4AFL|A Chain A, The Crystal Structure Of The Ing4 Dimerization Domain Reveals The Functional Organization Of The Ing Family Of Chromatin Binding Proteins. Length = 104 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 5e-30
1weu_A91 Inhibitor of growth family, member 4; structural g 1e-29
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 3e-29
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 8e-29
1x4i_A70 Inhibitor of growth protein 3; structural genomics 1e-28
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 8e-28
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 2e-27
4afl_A104 P29ING4, inhibitor of growth protein 4; cell cycle 2e-19
2k16_A75 Transcription initiation factor TFIID subunit 3; p 8e-16
1wem_A76 Death associated transcription factor 1; structura 4e-13
1wew_A78 DNA-binding family protein; structural genomics, P 7e-12
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 1e-10
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 1e-10
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-10
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 4e-10
3o70_A68 PHD finger protein 13; PHF13, structural genomics 1e-09
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 1e-08
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 3e-08
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 3e-08
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 3e-08
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 6e-08
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 7e-08
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 5e-07
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 9e-07
1we9_A64 PHD finger family protein; structural genomics, PH 1e-06
3kv5_D 488 JMJC domain-containing histone demethylation prote 2e-06
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 2e-06
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 5e-06
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 6e-06
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 6e-06
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 1e-05
1wee_A72 PHD finger family protein; structural genomics, PH 2e-05
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 3e-05
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 5e-05
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 9e-05
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 1e-04
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 1e-04
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 2e-04
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 3e-04
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 5e-04
2yt5_A66 Metal-response element-binding transcription facto 6e-04
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 8e-04
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
 Score =  107 bits (269), Expect = 5e-30
 Identities = 34/64 (53%), Positives = 47/64 (73%)

Query: 222 ATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCP 281
            +     D+ +DPNEPTYCLC+QVS+G+M+ CDN  C  +WFHF+CV +T  P+GKW+CP
Sbjct: 1   GSSGSSGDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP 60

Query: 282 NCRK 285
            C +
Sbjct: 61  RCSQ 64
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>4afl_A P29ING4, inhibitor of growth protein 4; cell cycle, tumour suppressor, chromatin remodelling; 2.28A {Homo sapiens} Length = 104 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
4afl_A104 P29ING4, inhibitor of growth protein 4; cell cycle 99.95
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.83
1weu_A91 Inhibitor of growth family, member 4; structural g 99.83
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.81
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.79
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.79
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.78
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.77
1wew_A78 DNA-binding family protein; structural genomics, P 99.69
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.61
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.48
1wem_A76 Death associated transcription factor 1; structura 99.46
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.46
1we9_A64 PHD finger family protein; structural genomics, PH 99.46
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.45
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.44
1wee_A72 PHD finger family protein; structural genomics, PH 99.44
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.43
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.4
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.24
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.23
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.21
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.21
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.18
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.16
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.16
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.14
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.14
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.12
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.12
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.11
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.11
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.08
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.07
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.02
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.99
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.91
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.9
2yt5_A66 Metal-response element-binding transcription facto 98.89
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.83
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.79
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 98.76
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 98.71
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.7
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.58
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.57
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.56
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 98.55
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.52
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.46
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.26
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.24
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.91
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.88
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.84
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.84
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.74
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 97.45
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.06
1wil_A89 KIAA1045 protein; ring finger domain, structural g 94.83
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 94.62
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 93.54
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 89.84
2xzr_A114 Immunoglobulin-binding protein EIBD; cell adhesion 87.37
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 86.89
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 85.41
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 84.22
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 81.87
>4afl_A P29ING4, inhibitor of growth protein 4; cell cycle, tumour suppressor, chromatin remodelling; 2.28A {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=1.4e-27  Score=192.69  Aligned_cols=100  Identities=28%  Similarity=0.430  Sum_probs=93.9

Q ss_pred             hhHHHHHHHHHhhcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC---cCChHHHHHHHHHHHHHHHHHHHHHHHH
Q psy16463         26 SVPYVETYLDIVENLPDEIQRYLTKIRELDVLYQSYMKEIEHIASQNGN---KIDQFSRKRNLLRVQVALIAAQEIGDEK  102 (317)
Q Consensus        26 ~a~yLedyld~ienLP~Elqr~l~lIRElD~k~~~~~~~ie~~~~~~~k---~~~~~~~~~~~~~I~~~l~~a~el~dEK  102 (317)
                      ++.|||+|+++|+|||.||+|+|++||+||.+++++++++++.+++|++   ...+.++.+.+..|++.|.++++++|||
T Consensus         2 ~~~yledyld~ie~LP~El~r~~~~irelD~~~~~~~~~i~~~~~~~~~~~~~~~~~~r~~~l~~I~~~~~~~~~l~dEK   81 (104)
T 4afl_A            2 AGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQEAYGKCKEFGDDK   81 (104)
T ss_dssp             CCHHHHHHHHSGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCChhhhHHHHHHHHHHHHHHHHHHHHH
Confidence            4789999999999999999999999999999999999999999999976   3467778888899999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhHhc
Q psy16463        103 LSIMQQVQDVIEGKTRQIDGIFY  125 (317)
Q Consensus       103 v~LA~q~~dlVdkhirrLD~dl~  125 (317)
                      |+||+++|+||++|++|||.+|+
T Consensus        82 v~lA~~~~dlvdkhirrLD~dla  104 (104)
T 4afl_A           82 VQLAMQTYEMVDKHIRRLDTDLA  104 (104)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHHHHHHhhhcC
Confidence            99999999999999999999974
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 317
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 2e-26
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 3e-23
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 8e-18
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 3e-12
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 4e-11
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 2e-10
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 2e-09
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 2e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 3e-08
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 5e-07
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 1e-06
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD Inhibitor of growth protein 2, Ing2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 97.7 bits (243), Expect = 2e-26
 Identities = 41/65 (63%), Positives = 50/65 (76%)

Query: 222 ATPPPDEDLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCP 281
            +     + AIDPNEPTYCLCNQVS+G+M+ CDN+ CP +WFHFSCV++T  PKGKWYCP
Sbjct: 1   GSSGSSGEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCP 60

Query: 282 NCRKA 286
            CR  
Sbjct: 61  KCRGD 65
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.7
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.67
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.42
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.31
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.14
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.13
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.1
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.0
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.92
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.88
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.88
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 92.87
d2v89a174 V(D)J recombination-activating protein 2, Rag2 {Mo 86.39
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD Inhibitor of growth protein 2, Ing2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.70  E-value=6.4e-18  Score=125.41  Aligned_cols=60  Identities=68%  Similarity=1.540  Sum_probs=53.0

Q ss_pred             CCCCCCCCCceeeeCCCCCCCeeeeCCCCCCCcceecccCCccCCCCCceeCcccccccc
Q psy16463        229 DLAIDPNEPTYCLCNQVSFGQMVMCDNDLCPHQWFHFSCVAVTNTPKGKWYCPNCRKARS  288 (317)
Q Consensus       229 ~~~~d~~e~~~C~C~~~~~g~mi~Cd~~~C~~~wfH~~Cvgl~~~p~~~w~C~~C~~~~~  288 (317)
                      +.++|+++.+||||+++..++||.|++..|.+.|||+.||+|+..|.++||||.|+....
T Consensus         8 ~~~~d~~e~~~CiC~~~~~~~~i~c~~~~C~~~wfH~~Cvgl~~~p~~~w~C~~C~~~~g   67 (71)
T d1wesa_           8 EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSG   67 (71)
T ss_dssp             CSCCCSSSCCCSTTCCCCCSSEECCSCTTCSCCCEETTTTTCSSCCSSCCCCTTTSSCCS
T ss_pred             CCCcCCCCCCEEEeCCCCCCCEEEEECCCCCCcCccCccCCCCcCCCCcEECcCCccccC
Confidence            457888999999999988889999887778768999999999999999999999986644
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2v89a1 g.50.1.2 (A:1414-1487) V(D)J recombination-activating protein 2, Rag2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure