Diaphorina citri psyllid: psy16466

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MMEYYLPDVRDRQFLIHLHKRAKKVGFPLEQYNCLKNECGKLENDLARLRDPLIPPYRGYEFQVPSDLSYKQPSSSINKFKEQIKMILSKQSHGANKNDTS
ccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccc
MMEYYLPDVRDRQFLIHLHKRAKKVGFPLEQYNCLKNECGKLENDLARLRDPLIPPYRGYEFQV*************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMEYYLPDVRDRQFLIHLHKRAKKVGFPLEQYNCLKNECGKLENDLARLRDPLIPPYRGYEFQVPSDLSYKQPSSSINKFKEQIKMILSKQSHGANKNDTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium uniporter protein, mitochondrial Mitochondrial inner membrane calcium transporter that mediates calcium uptake into mitochondrion.confidentQ8NE86
Calcium uniporter protein, mitochondrial Mitochondrial inner membrane calcium transporter that mediates calcium uptake into mitochondrion.confidentQ08BI9
Calcium uniporter protein, mitochondrial Mitochondrial inner membrane calcium transporter that mediates calcium uptake into mitochondrion.confidentQ3UMR5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032024 [BP]positive regulation of insulin secretionprobableGO:0090087, GO:0051046, GO:0051047, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048518, GO:0051050, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046887, GO:0032879, GO:0002791, GO:0002793, GO:0090277, GO:0048522
GO:0005262 [MF]calcium channel activityprobableGO:0022891, GO:0015085, GO:0022892, GO:0005261, GO:0022890, GO:0005215, GO:0005216, GO:0008324, GO:0072509, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0046873, GO:0022838
GO:0019722 [BP]calcium-mediated signalingprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0035786 [BP]protein complex oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0015292 [MF]uniporter activityprobableGO:0005215, GO:0022857, GO:0015291, GO:0003674, GO:0022804
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0042593 [BP]glucose homeostasisprobableGO:0033500, GO:0048878, GO:0042592, GO:0008150, GO:0065007, GO:0065008

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted