Psyllid ID: psy1646


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MNGEMVDLSRGLKSDGLEEEWDDDIKKSATEGKQTQRDTRGPRRHKKEYISSINKGARSATPCTTPRSPRERAARPYTKTSGGGSGRGSSGGDRKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEEEcccccEEEEEEEEcccccccccHHHHHHHHHHHHHcccccEEccccccccccccccc
cccccccccccccccccHHHHccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHccEEEEEccccccHEEEEEEcccccEEEEEEEEcccEEEcccccHHHHHHHHHHHHHccccHHHEEEHHccccccccc
mngemvdlsrglksdgleeewddDIKKSATegkqtqrdtrgprrhkkEYISSINkgarsatpcttprspreraarpytktsgggsgrgssggdrkvgleDFHFIKVlgkgsfgkvmlaekrgssdevYAVKVLKKdviiqdddvdcTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
mngemvdlsrglksdgleeewdddikksategkqtqrdtrgprrhkkeyissinkgarsatpcttprspreraarpytktsgggsgrgssggdRKVGLEDFHFIKvlgkgsfgkVMLAEkrgssdevyaVKVLkkdviiqdddvDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
MNGEMVDLSRGLKSDGLEEEWDDDIKKSATEGKQTQRDTRGPRRHKKEYISSINKGARSATPCTTPRSPRERAARPYTKTsgggsgrgssggDRKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAvkvlkkdviiqdddvdCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
***********************************************************************************************VGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKV****
MNGEMVDLSRGLKS*************************************************************************************DFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
*********RGLKSDGLEEEWDDDIKKS*******************EYISSIN**************************************DRKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
**********************************************************************************************KVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGEMVDLSRGLKSDGLEEEWDDDIKKSATEGKQTQRDTRGPRRHKKEYISSINKGARSATPCTTPRSPRERAARPYTKTSGGGSGRGSSGGDRKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
P13678 634 Protein kinase C OS=Droso no N/A 0.533 0.149 0.744 5e-34
Q16975 743 Calcium-independent prote N/A N/A 0.460 0.110 0.819 1e-32
P09216 737 Protein kinase C epsilon yes N/A 0.550 0.132 0.696 2e-32
Q02156 737 Protein kinase C epsilon yes N/A 0.544 0.131 0.704 2e-32
P16054 737 Protein kinase C epsilon yes N/A 0.550 0.132 0.696 2e-32
P10830 736 Protein kinase C epsilon yes N/A 0.522 0.126 0.712 1e-31
P34885 707 Protein kinase C-like 1B yes N/A 0.533 0.134 0.673 4e-30
P05126 671 Protein kinase C beta typ no N/A 0.589 0.156 0.566 5e-29
Q7SY24 670 Protein kinase C beta typ no N/A 0.623 0.165 0.586 5e-29
P05771 671 Protein kinase C beta typ no N/A 0.573 0.152 0.601 5e-29
>sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 Back     alignment and function desciption
 Score =  143 bits (361), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 81/98 (82%), Gaps = 3/98 (3%)

Query: 83  GGSGRGSSGGDR--KVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQ 140
           G  G G++G  R  K  L DF+FIKVLGKGSFGKVMLAEK+G+ DE+YA+KVLKKD IIQ
Sbjct: 283 GSGGVGATGETRPGKCSLLDFNFIKVLGKGSFGKVMLAEKKGT-DEIYAIKVLKKDAIIQ 341

Query: 141 DDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF 178
           DDDVDCTMTEKRILALAA HPFLTALHSCFQT  +  F
Sbjct: 342 DDDVDCTMTEKRILALAANHPFLTALHSCFQTPDRLFF 379




PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 3
>sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 Back     alignment and function description
>sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 Back     alignment and function description
>sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 Back     alignment and function description
>sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 Back     alignment and function description
>sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 Back     alignment and function description
>sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 Back     alignment and function description
>sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 Back     alignment and function description
>sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 Back     alignment and function description
>sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
345492763 736 PREDICTED: calcium-independent protein k 0.842 0.203 0.544 8e-37
321472391 715 hypothetical protein DAPPUDRAFT_301963 [ 0.533 0.132 0.762 5e-34
170072840 405 kinase C epsilon type [Culex quinquefasc 0.528 0.232 0.762 3e-33
347968488 808 AGAP002748-PA [Anopheles gambiae str. PE 0.533 0.117 0.757 6e-33
312372041 472 hypothetical protein AND_20683 [Anophele 0.511 0.192 0.778 6e-33
291239731 757 PREDICTED: putative protein kinase C eps 0.584 0.137 0.693 7e-33
157110821 750 protein kinase c [Aedes aegypti] gi|1088 0.511 0.121 0.776 8e-33
195036392 736 GH18675 [Drosophila grimshawi] gi|193893 0.505 0.122 0.784 1e-32
24650924 739 protein C kinase 98E, isoform A [Drosoph 0.533 0.128 0.744 2e-32
125547 634 RecName: Full=Protein kinase C; Short=PK 0.533 0.149 0.744 2e-32
>gi|345492763|ref|XP_003426921.1| PREDICTED: calcium-independent protein kinase C-like isoform 2 [Nasonia vitripennis] gi|345492765|ref|XP_001599367.2| PREDICTED: calcium-independent protein kinase C-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  158 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 85/156 (54%), Positives = 106/156 (67%), Gaps = 6/156 (3%)

Query: 29  ATEGKQTQRDTRGPRRHKKEYISSINKGARSATPCTTPRSPRERAARPYTKTSGGGSGRG 88
           +T G    +  + PR + K  I S N    ++   T+P   ++++++   K    G+  G
Sbjct: 322 STIGISPDKQIKAPRINYKPSIPSSNTPTSTSLNETSPGVNQDQSSQQAQKPKDSGTASG 381

Query: 89  SS---GGD---RKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDD 142
            S   GG     K+ + DF+FIKVLGKGSFGKVMLAE++G  DEVYAVKVLKKDVIIQDD
Sbjct: 382 ESAISGGQDDIHKISINDFNFIKVLGKGSFGKVMLAERKGHPDEVYAVKVLKKDVIIQDD 441

Query: 143 DVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF 178
           DV+CTMTEKRIL LAAKHPFLTALHSCFQTK +  F
Sbjct: 442 DVECTMTEKRILVLAAKHPFLTALHSCFQTKERLFF 477




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321472391|gb|EFX83361.1| hypothetical protein DAPPUDRAFT_301963 [Daphnia pulex] Back     alignment and taxonomy information
>gi|170072840|ref|XP_001870272.1| kinase C epsilon type [Culex quinquefasciatus] gi|167869314|gb|EDS32697.1| kinase C epsilon type [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347968488|ref|XP_312175.5| AGAP002748-PA [Anopheles gambiae str. PEST] gi|333467980|gb|EAA07888.5| AGAP002748-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312372041|gb|EFR20091.1| hypothetical protein AND_20683 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|291239731|ref|XP_002739777.1| PREDICTED: putative protein kinase C epsilon-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|157110821|ref|XP_001651260.1| protein kinase c [Aedes aegypti] gi|108883861|gb|EAT48086.1| AAEL000810-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195036392|ref|XP_001989654.1| GH18675 [Drosophila grimshawi] gi|193893850|gb|EDV92716.1| GH18675 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|24650924|ref|NP_524545.2| protein C kinase 98E, isoform A [Drosophila melanogaster] gi|7301734|gb|AAF56846.1| protein C kinase 98E, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|125547|sp|P13678.1|KPC3_DROME RecName: Full=Protein kinase C; Short=PKC; AltName: Full=dPKC98F gi|158129|gb|AAA28818.1| protein kinase C [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
WB|WBGene00004032 763 pkc-1 [Caenorhabditis elegans 0.460 0.107 0.590 2.2e-21
FB|FBgn0003093 634 Pkc98E "Protein C kinase 98E" 0.466 0.130 0.642 6.1e-21
UNIPROTKB|E9PBI2219 PRKCE "Protein kinase C epsilo 0.443 0.360 0.612 2.7e-20
UNIPROTKB|F1NG47 610 PRKCE "Uncharacterized protein 0.471 0.137 0.6 4.1e-20
UNIPROTKB|F1LMV8 546 Prkce "Protein kinase C epsilo 0.471 0.153 0.588 1.1e-19
UNIPROTKB|F1S5K7 600 PRKCE "Uncharacterized protein 0.471 0.14 0.588 1.4e-19
UNIPROTKB|P10830 736 PRKCE "Protein kinase C epsilo 0.471 0.114 0.588 2e-19
UNIPROTKB|F1MDC9 737 PRKCE "Uncharacterized protein 0.471 0.113 0.588 2e-19
UNIPROTKB|Q02156 737 PRKCE "Protein kinase C epsilo 0.471 0.113 0.588 2e-19
MGI|MGI:97599 737 Prkce "protein kinase C, epsil 0.471 0.113 0.588 2e-19
WB|WBGene00004032 pkc-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 231 (86.4 bits), Expect = 2.2e-21, Sum P(3) = 2.2e-21
 Identities = 49/83 (59%), Positives = 57/83 (68%)

Query:    96 VGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAXXXXXXXXXXXXXXXXCTMTEKRILA 155
             + + DF F+KVLGKGSFGKVMLAE++G+ DEVYA                CTM EKRIL+
Sbjct:   429 LSIHDFTFMKVLGKGSFGKVMLAERKGT-DEVYAIKILKKDVIVQDDDVECTMCEKRILS 487

Query:   156 LAAKHPFLTALHSCFQTKVKCSF 178
             LAAKHPFLTALHS FQT  +  F
Sbjct:   488 LAAKHPFLTALHSSFQTSDRLFF 510


GO:0004697 "protein kinase C activity" evidence=IEA;IDA
GO:0004672 "protein kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0007269 "neurotransmitter secretion" evidence=IMP
GO:0006935 "chemotaxis" evidence=IMP
GO:0040012 "regulation of locomotion" evidence=IMP
FB|FBgn0003093 Pkc98E "Protein C kinase 98E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E9PBI2 PRKCE "Protein kinase C epsilon type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG47 PRKCE "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LMV8 Prkce "Protein kinase C epsilon type" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5K7 PRKCE "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P10830 PRKCE "Protein kinase C epsilon type" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDC9 PRKCE "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q02156 PRKCE "Protein kinase C epsilon type" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97599 Prkce "protein kinase C, epsilon" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P36583PCK2_SCHPO2, ., 7, ., 1, 1, ., 1, 30.54020.47190.0826yesN/A
P16054KPCE_MOUSE2, ., 7, ., 1, 1, ., 1, 30.69690.55050.1329yesN/A
P09216KPCE_RAT2, ., 7, ., 1, 1, ., 1, 30.69690.55050.1329yesN/A
Q00078KPC1_ASPNG2, ., 7, ., 1, 1, ., 1, 30.53480.46620.0757yesN/A
P10830KPCE_RABIT2, ., 7, ., 1, 1, ., 1, 30.71270.52240.1263yesN/A
P34885KPC1B_CAEEL2, ., 7, ., 1, 1, ., 1, 30.67320.53370.1343yesN/A
Q02156KPCE_HUMAN2, ., 7, ., 1, 1, ., 1, 30.70400.54490.1316yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 5e-43
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 3e-42
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-40
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 2e-36
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 3e-33
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 8e-33
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 6e-30
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 3e-27
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 4e-27
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 3e-26
cd05123 250 cd05123, STKc_AGC, Catalytic domain of AGC family 6e-23
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 4e-20
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 2e-19
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-18
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 6e-18
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-17
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 4e-17
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 9e-17
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-16
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 4e-16
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 9e-16
cd05583 288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 1e-15
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 2e-15
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-15
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 4e-15
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 5e-15
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 8e-15
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 1e-14
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 1e-13
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 4e-12
cd05613 290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 4e-12
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 7e-12
PTZ00426 340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 9e-12
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-11
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 3e-11
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 8e-11
cd05578 258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-10
cd05585 312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 5e-10
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-09
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 4e-09
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 5e-09
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 7e-09
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 2e-08
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-08
cd05611 260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-08
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 3e-08
cd05597 331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 8e-08
cd05601 330 cd05601, STKc_CRIK, Catalytic domain of the Protei 1e-07
cd08530 256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-07
cd05572 262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 3e-07
cd05623 332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 3e-07
cd05624 331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 3e-07
cd05621 370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 3e-07
cd05622 371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 9e-07
cd08215 258 cd08215, STKc_Nek, Catalytic domain of the Protein 1e-06
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 1e-06
cd05628 363 cd05628, STKc_NDR1, Catalytic domain of the Protei 2e-06
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-06
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 8e-06
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 8e-06
cd05627 360 cd05627, STKc_NDR2, Catalytic domain of the Protei 1e-05
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-05
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 5e-05
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 7e-05
cd06613 262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 2e-04
cd05049 280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-04
cd05608 280 cd05608, STKc_GRK1, Catalytic domain of the Protei 3e-04
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-04
cd05625 382 cd05625, STKc_LATS1, Catalytic domain of the Prote 3e-04
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 5e-04
cd08225 257 cd08225, STKc_Nek5, Catalytic domain of the Protei 5e-04
cd05626 381 cd05626, STKc_LATS2, Catalytic domain of the Prote 8e-04
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 0.001
cd08219 255 cd08219, STKc_Nek3, Catalytic domain of the Protei 0.001
cd05577 277 cd05577, STKc_GRK, Catalytic domain of the Protein 0.002
cd05605 285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 0.002
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 0.003
cd05082 256 cd05082, PTKc_Csk, Catalytic domain of the Protein 0.003
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 0.003
cd05106 374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 0.004
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
 Score =  145 bits (367), Expect = 5e-43
 Identities = 63/74 (85%), Positives = 68/74 (91%), Gaps = 1/74 (1%)

Query: 105 KVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLT 164
           KVLGKGSFGKVMLAE +G+ DEVYA+KVLKKDVI+QDDDVDCTMTEKRILALAAKHPFLT
Sbjct: 1   KVLGKGSFGKVMLAELKGT-DEVYAIKVLKKDVILQDDDVDCTMTEKRILALAAKHPFLT 59

Query: 165 ALHSCFQTKVKCSF 178
           ALH CFQTK +  F
Sbjct: 60  ALHCCFQTKDRLFF 73


Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to neoplastic transformation depending on the cell type. It contributes to oncogenesis by inducing disordered cell growth and inhibiting cell death. It also plays a role in tumor invasion and metastasis. PKC-epsilon has also been found to confer cardioprotection against ischemia and reperfusion-mediated damage. Other cellular functions include the regulation of gene expression, cell adhesion, and cell motility. Length = 321

>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
KOG0575|consensus 592 99.62
KOG0598|consensus 357 99.6
KOG0605|consensus 550 99.57
KOG0580|consensus 281 99.57
KOG0595|consensus 429 99.56
KOG0694|consensus 694 99.56
KOG0615|consensus 475 99.53
KOG0592|consensus 604 99.42
KOG0585|consensus 576 99.42
KOG0597|consensus 808 99.41
KOG0616|consensus 355 99.4
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.39
KOG0593|consensus 396 99.37
KOG0659|consensus 318 99.37
KOG0032|consensus 382 99.35
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.35
KOG0581|consensus 364 99.34
KOG0600|consensus 560 99.34
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.33
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.32
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.3
KOG0610|consensus 459 99.3
KOG0591|consensus 375 99.3
KOG0582|consensus 516 99.3
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.29
KOG0611|consensus 668 99.29
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.29
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.27
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.26
KOG0586|consensus 596 99.25
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.25
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.25
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.25
KOG4236|consensus 888 99.25
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.24
KOG0583|consensus 370 99.23
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.22
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.22
KOG0588|consensus 786 99.22
KOG0194|consensus 474 99.22
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.2
KOG0690|consensus 516 99.2
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.2
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.2
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.2
KOG1152|consensus 772 99.19
KOG4717|consensus 864 99.19
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.19
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.19
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.19
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.19
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.18
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.18
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.18
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.17
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.16
KOG0663|consensus 419 99.16
KOG0695|consensus 593 99.14
PHA03212 391 serine/threonine kinase US3; Provisional 99.13
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.13
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.13
KOG0667|consensus 586 99.13
KOG0662|consensus 292 99.13
KOG1035|consensus 1351 99.12
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.12
KOG1094|consensus 807 99.12
KOG1026|consensus 774 99.12
KOG0612|consensus 1317 99.11
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.11
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.11
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.11
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.11
KOG0661|consensus 538 99.11
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.11
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.1
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.1
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.1
KOG0594|consensus 323 99.1
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.1
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.1
KOG0197|consensus 468 99.1
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.09
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.09
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.09
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.09
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.09
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.09
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.09
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.08
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.08
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.08
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.08
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.07
PHA03207 392 serine/threonine kinase US3; Provisional 99.07
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.07
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.07
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.07
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.06
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.06
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.05
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.05
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.05
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.05
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.05
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.04
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.04
PLN00009 294 cyclin-dependent kinase A; Provisional 99.04
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.04
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.03
KOG0192|consensus 362 99.03
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.03
KOG1187|consensus 361 99.03
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.03
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.03
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.02
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.02
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.02
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.02
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.02
KOG0193|consensus 678 99.01
KOG0589|consensus 426 99.01
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.01
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.01
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.0
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.0
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.0
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.0
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.0
KOG0696|consensus 683 99.0
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.0
KOG0201|consensus 467 99.0
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.0
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 98.99
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 98.99
KOG0607|consensus 463 98.99
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.99
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 98.99
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 98.99
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 98.99
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 98.99
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 98.98
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 98.98
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 98.98
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 98.98
KOG0658|consensus 364 98.98
KOG0579|consensus 1187 98.98
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 98.98
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 98.97
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 98.97
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 98.97
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 98.97
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 98.97
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 98.96
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 98.96
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 98.96
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 98.96
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 98.96
PHA03210 501 serine/threonine kinase US3; Provisional 98.96
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 98.96
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 98.96
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 98.96
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 98.95
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 98.95
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 98.95
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.95
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 98.95
KOG4250|consensus 732 98.95
KOG0033|consensus 355 98.95
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 98.95
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 98.94
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 98.94
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 98.94
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 98.94
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 98.94
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 98.94
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 98.93
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 98.93
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 98.93
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 98.93
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 98.93
KOG0574|consensus 502 98.93
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 98.93
PHA03209 357 serine/threonine kinase US3; Provisional 98.93
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 98.92
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 98.92
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 98.92
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 98.92
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 98.91
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 98.91
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 98.91
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 98.91
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 98.91
PTZ00267 478 NIMA-related protein kinase; Provisional 98.9
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 98.9
PTZ00284 467 protein kinase; Provisional 98.9
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 98.9
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 98.9
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.9
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 98.9
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 98.9
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 98.89
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 98.89
PHA03211 461 serine/threonine kinase US3; Provisional 98.89
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 98.89
PTZ00036 440 glycogen synthase kinase; Provisional 98.89
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 98.88
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 98.88
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 98.88
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 98.88
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 98.88
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 98.88
KOG1095|consensus 1025 98.88
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 98.88
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 98.88
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 98.88
KOG1290|consensus 590 98.88
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.88
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 98.88
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 98.87
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 98.87
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 98.87
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 98.86
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 98.86
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 98.86
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 98.86
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 98.86
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 98.86
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 98.86
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.85
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 98.85
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 98.85
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 98.85
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 98.84
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 98.84
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 98.84
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 98.84
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 98.84
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.84
PTZ00283 496 serine/threonine protein kinase; Provisional 98.83
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 98.83
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 98.83
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 98.83
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.83
KOG0198|consensus 313 98.83
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 98.83
KOG0608|consensus 1034 98.82
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 98.82
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 98.82
KOG0660|consensus 359 98.82
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 98.82
KOG0577|consensus 948 98.82
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 98.82
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 98.81
PRK09188 365 serine/threonine protein kinase; Provisional 98.81
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.81
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 98.81
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 98.81
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.81
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 98.81
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 98.81
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.81
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 98.8
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 98.8
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 98.8
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 98.8
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 98.8
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 98.8
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 98.79
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 98.79
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.79
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 98.79
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 98.79
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 98.79
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.79
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.79
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 98.78
KOG1006|consensus 361 98.78
KOG4257|consensus 974 98.78
KOG0199|consensus 1039 98.78
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 98.78
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 98.78
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.78
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 98.77
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 98.77
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.77
KOG0983|consensus 391 98.77
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 98.77
KOG0196|consensus 996 98.76
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 98.76
PTZ00024 335 cyclin-dependent protein kinase; Provisional 98.75
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 98.75
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.75
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 98.75
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 98.75
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 98.75
PHA02988 283 hypothetical protein; Provisional 98.74
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.74
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 98.74
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 98.74
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 98.74
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 98.74
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 98.74
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 98.73
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 98.73
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 98.73
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.73
KOG4278|consensus 1157 98.73
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 98.73
KOG1989|consensus 738 98.73
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 98.73
KOG2345|consensus 302 98.72
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.72
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 98.72
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 98.72
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 98.71
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 98.7
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 98.69
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.69
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 98.68
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 98.68
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 98.68
KOG0614|consensus 732 98.68
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 98.68
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.68
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 98.68
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 98.67
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 98.67
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 98.67
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 98.66
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 98.66
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 98.66
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 98.66
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 98.66
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.66
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 98.65
KOG0986|consensus 591 98.65
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 98.65
KOG0666|consensus 438 98.65
KOG0668|consensus 338 98.65
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.64
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 98.64
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 98.63
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 98.63
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 98.62
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 98.62
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.62
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 98.62
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 98.61
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 98.61
KOG0584|consensus 632 98.61
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.6
KOG0578|consensus 550 98.6
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 98.6
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 98.6
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 98.59
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 98.59
KOG0576|consensus 829 98.58
KOG1151|consensus 775 98.58
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 98.57
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.57
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 98.56
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 98.55
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 98.55
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 98.54
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 98.51
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 98.51
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 98.5
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 98.49
KOG2052|consensus 513 98.49
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 98.49
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.48
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 98.48
KOG4279|consensus 1226 98.48
KOG1025|consensus 1177 98.46
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 98.44
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 98.44
PRK10345 210 hypothetical protein; Provisional 98.44
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.42
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 98.41
KOG0587|consensus 953 98.36
KOG0599|consensus 411 98.36
KOG0596|consensus 677 98.33
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 98.29
KOG0984|consensus 282 98.23
KOG0670|consensus 752 98.23
KOG4645|consensus 1509 98.16
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 98.15
cd00180 215 PKc Catalytic domain of Protein Kinases. Protein K 98.07
KOG0200|consensus 609 98.07
KOG0604|consensus 400 98.06
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.06
KOG0671|consensus 415 98.05
PRK10359 232 lipopolysaccharide core biosynthesis protein; Prov 98.05
KOG0669|consensus 376 98.03
KOG3653|consensus 534 98.02
KOG1163|consensus 341 98.0
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 97.95
KOG4721|consensus 904 97.86
PHA02882 294 putative serine/threonine kinase; Provisional 97.82
KOG1167|consensus 418 97.82
KOG1345|consensus 378 97.81
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 97.8
KOG0603|consensus 612 97.79
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 97.78
KOG1165|consensus 449 97.74
KOG1164|consensus 322 97.72
PRK14879 211 serine/threonine protein kinase; Provisional 97.71
KOG0664|consensus 449 97.67
smart00090 237 RIO RIO-like kinase. 97.65
KOG1027|consensus 903 97.64
TIGR03724 199 arch_bud32 Kae1-associated kinase Bud32. Members o 97.43
COG0515 384 SPS1 Serine/threonine protein kinase [General func 97.29
PRK09605 535 bifunctional UGMP family protein/serine/threonine 97.28
cd05119 187 RIO RIO kinase family, catalytic domain. The RIO k 97.22
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 97.11
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 97.08
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 96.83
PRK12274 218 serine/threonine protein kinase; Provisional 96.67
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 96.41
KOG1033|consensus 516 95.98
KOG0603|consensus 612 95.93
KOG0665|consensus 369 95.85
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 95.38
KOG1024|consensus 563 95.33
KOG1166|consensus 974 94.77
PF14531 288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 94.57
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 94.48
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 94.45
KOG1243|consensus 690 94.0
COG2112 201 Predicted Ser/Thr protein kinase [Signal transduct 93.7
KOG0601|consensus 524 93.41
PRK01723 239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 92.89
KOG0601|consensus 524 92.72
KOG0195|consensus 448 92.16
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 91.91
cd05154 223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 90.52
KOG0606|consensus 1205 89.32
COG0661 517 AarF Predicted unusual protein kinase [General fun 87.75
KOG0590|consensus 601 82.13
KOG3741|consensus 655 81.84
KOG1240|consensus 1431 80.46
>KOG0575|consensus Back     alignment and domain information
Probab=99.62  E-value=1.4e-15  Score=123.75  Aligned_cols=78  Identities=24%  Similarity=0.357  Sum_probs=74.2

Q ss_pred             CCeEEEeeeccCCCeeEEEEEEeCCCCCeEEEEeeecccccccchhhhHHHHHHHHHHhcCCCCccccceeEEeCCeEeC
Q psy1646          99 EDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF  178 (178)
Q Consensus        99 ~~~~~~~~lG~G~fg~V~~~~~~~~~~~~~aiK~i~~~~~~~~~~~~~~~~Ei~il~~l~~hp~iv~l~~~~~~~~~~yl  178 (178)
                      ..|+..++||+|+|..||.+.+..+ |..||+|+|.+..+......+++.+||+|++.| .|||||++|++|++.+++||
T Consensus        18 ~~Y~~g~~LGkGgFA~cYe~~~~~t-ge~~A~KvVpk~~l~k~~~reKv~~EIeIHr~L-~HpnIV~f~~~FEDs~nVYi   95 (592)
T KOG0575|consen   18 KRYKRGRFLGKGGFARCYEARDLDT-GEVVAVKVVPKKLLKKPKQREKVLNEIEIHRSL-KHPNIVQFYHFFEDSNNVYI   95 (592)
T ss_pred             ceeeeeeeeccCcceEEEEEEEcCC-CcEEEEEEeehHHhcCcchHHHHHHHHHHHHhc-CCCcEEeeeeEeecCCceEE
Confidence            5699999999999999999999888 999999999988777788899999999999999 99999999999999999996



>KOG0598|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG3741|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 2e-18
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 3e-18
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 7e-18
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 9e-17
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 6e-13
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 1e-12
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 1e-11
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 1e-11
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 1e-11
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 1e-11
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 2e-11
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 2e-09
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 4e-09
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 4e-09
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 5e-09
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 5e-09
1gzk_A 315 Molecular Mechanism For The Regulation Of Protein K 5e-09
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 5e-09
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 5e-09
3o96_A 446 Crystal Structure Of Human Akt1 With An Allosteric 7e-09
4ejn_A 446 Crystal Structure Of Autoinhibited Form Of Akt1 In 7e-09
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 1e-08
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 1e-08
1vzo_A 355 The Structure Of The N-Terminal Kinase Domain Of Ms 8e-08
3g51_A 325 Structural Diversity Of The Active Conformation Of 3e-06
3ubd_A 304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 4e-06
4el9_A 305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 4e-06
2z7q_A 321 Crystal Structure Of The N-Terminal Kinase Domain O 9e-06
1j3h_A 350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 7e-05
3fhi_A 350 Crystal Structure Of A Complex Between The Catalyti 8e-05
3pvb_A 345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 8e-05
1rdq_E 350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 8e-05
3o7l_B 350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 8e-05
2erz_E 351 Crystal Structure Of C-amp Dependent Kinase (pka) B 8e-05
1fmo_E 350 Crystal Structure Of A Polyhistidine-Tagged Recombi 8e-05
3qam_E 350 Crystal Structure Of Glu208ala Mutant Of Catalytic 8e-05
2qur_A 350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 8e-05
1l3r_E 350 Crystal Structure Of A Transition State Mimic Of Th 8e-05
1jbp_E 350 Crystal Structure Of The Catalytic Subunit Of Camp- 8e-05
1syk_A 350 Crystal Structure Of E230q Mutant Of Camp-Dependent 8e-05
2qcs_A 350 A Complex Structure Between The Catalytic And Regul 8e-05
1bkx_A 350 A Binary Complex Of The Catalytic Subunit Of Camp-D 8e-05
1apm_E 350 2.0 Angstrom Refined Crystal Structure Of The Catal 8e-05
3qal_E 350 Crystal Structure Of Arg280ala Mutant Of Catalytic 8e-05
2gu8_A 337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 8e-05
4dfy_A 371 Crystal Structure Of R194a Mutant Of Camp-Dependent 9e-05
4dg3_E 371 Crystal Structure Of R336a Mutant Of Camp-dependent 9e-05
4dfx_E 350 Crystal Structure Of Myristoylated K7c Catalytic Su 9e-05
2vo0_A 351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 1e-04
2uvy_A 351 Structure Of Pka-pkb Chimera Complexed With Methyl- 1e-04
2jdt_A 351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 1e-04
3orx_A 316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 1e-04
4ae6_A 343 Structure And Function Of The Human Sperm-specific 1e-04
3l9m_A 351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 1e-04
3agm_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 1e-04
3agl_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 1e-04
3nx8_A 351 Human Camp Dependent Protein Kinase In Complex With 1e-04
4ae9_A 343 Structure And Function Of The Human Sperm-specific 1e-04
3mvj_A 371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 1e-04
2f7e_E 351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 3e-04
1svh_A 350 Crystal Structure Of Protein Kinase A In Complex Wi 3e-04
1ydt_E 350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 3e-04
1szm_A 350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 3e-04
3dnd_A 350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 3e-04
1q8w_A 350 The Catalytic Subunit Of Camp-Dependent Protein Kin 3e-04
1q61_A 350 Pka Triple Mutant Model Of Pkb Length = 350 3e-04
1stc_E 350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 3e-04
1q24_A 350 Pka Double Mutant Model Of Pkb In Complex With Mgat 3e-04
2uzt_A 336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 3e-04
2c1a_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 3e-04
1xh7_A 350 Crystal Structures Of Protein Kinase B Selective In 3e-04
2jds_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 3e-04
1xh9_A 350 Crystal Structures Of Protein Kinase B Selective In 3e-04
1smh_A 350 Protein Kinase A Variant Complex With Completely Or 3e-04
1cmk_E 350 Crystal Structures Of The Myristylated Catalytic Su 3e-04
1cdk_A 350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 3e-04
1ctp_E 350 Structure Of The Mammalian Catalytic Subunit Of Cam 3e-04
2gnf_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 6e-04
2gnj_A 350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 6e-04
2gng_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 6e-04
3qfv_A 415 Mrck Beta In Complex With Tpca-1 Length = 415 7e-04
3tku_A 433 Mrck Beta In Complex With Fasudil Length = 433 7e-04
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure

Iteration: 1

Score = 88.2 bits (217), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 1/84 (1%) Query: 95 KVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAXXXXXXXXXXXXXXXXCTMTEKRIL 154 ++ L DF+F+ VLGKGSFGKVML+E++G+ DE+YA CTM EKR+L Sbjct: 16 RMKLTDFNFLMVLGKGSFGKVMLSERKGT-DELYAVKILKKDVVIQDDDVECTMVEKRVL 74 Query: 155 ALAAKHPFLTALHSCFQTKVKCSF 178 AL K PFLT LHSCFQT + F Sbjct: 75 ALPGKPPFLTQLHSCFQTMDRLYF 98
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 2e-49
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 5e-49
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 7e-49
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 1e-48
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 3e-48
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-48
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-46
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 1e-44
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-42
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-42
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 3e-42
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 3e-41
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-39
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-39
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 2e-38
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 1e-36
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 3e-36
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 1e-35
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 3e-35
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 1e-34
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 3e-34
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 1e-33
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-19
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 9e-19
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 4e-18
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 3e-14
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 2e-13
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 1e-12
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 4e-12
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 3e-11
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-11
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 6e-11
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 9e-11
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-10
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-10
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 1e-10
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 2e-10
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 2e-10
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 3e-10
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 3e-10
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 3e-10
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 6e-10
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 9e-10
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-09
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 1e-09
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 1e-09
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 1e-09
2a19_B 284 Interferon-induced, double-stranded RNA-activated 1e-09
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 3e-09
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 4e-09
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 6e-09
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 7e-09
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 7e-09
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 8e-09
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 8e-09
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 8e-09
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 1e-08
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-08
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 1e-08
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 2e-08
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 2e-08
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 2e-08
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 3e-08
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 4e-08
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 4e-08
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 4e-08
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 4e-08
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 8e-08
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 1e-07
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 1e-07
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 1e-07
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-07
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 1e-07
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 1e-07
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 1e-07
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 2e-07
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 2e-07
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 2e-07
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-07
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 2e-07
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-07
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 3e-07
3bhy_A 283 Death-associated protein kinase 3; death associate 4e-07
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 4e-07
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 5e-07
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 5e-07
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 6e-07
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 7e-07
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 7e-07
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-06
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-06
3an0_A 340 Dual specificity mitogen-activated protein kinase; 1e-06
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 2e-06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-06
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 2e-06
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 2e-06
3aln_A 327 Dual specificity mitogen-activated protein kinase; 2e-06
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 3e-06
2dyl_A 318 Dual specificity mitogen-activated protein kinase 4e-06
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 4e-06
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 4e-06
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 5e-06
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 5e-06
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 5e-06
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 6e-06
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 6e-06
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 6e-06
3fme_A 290 Dual specificity mitogen-activated protein kinase; 7e-06
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 7e-06
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 8e-06
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 8e-06
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 1e-05
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-05
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-05
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-05
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-05
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-05
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 3e-05
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 4e-05
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 4e-05
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 5e-05
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 5e-05
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 5e-05
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 5e-05
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 6e-05
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 7e-05
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 7e-05
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 7e-05
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 7e-05
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 9e-05
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 1e-04
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-04
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 1e-04
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 1e-04
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-04
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-04
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-04
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-04
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 1e-04
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-04
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 2e-04
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-04
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-04
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-04
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 2e-04
3soc_A 322 Activin receptor type-2A; structural genomics cons 2e-04
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 2e-04
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 2e-04
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 2e-04
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 3e-04
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 3e-04
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 4e-04
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 4e-04
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 4e-04
4aoj_A 329 High affinity nerve growth factor receptor; transf 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 6e-04
3q4u_A 301 Activin receptor type-1; structural genomics conso 8e-04
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 8e-04
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
 Score =  162 bits (412), Expect = 2e-49
 Identities = 42/110 (38%), Positives = 57/110 (51%), Gaps = 1/110 (0%)

Query: 66  PRSPRERAARPYTKTSGGGSGRGSSGGDRKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSD 125
           P+ P    A P    +           +      DFHF+KV+GKGSFGKV+LA  +   +
Sbjct: 5   PQEPELMNANPAPPPAPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE-E 63

Query: 126 EVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVK 175
             YAVKVL+K  I++  +    M+E+ +L    KHPFL  LH  FQT  K
Sbjct: 64  VFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADK 113


>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.74
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.7
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.7
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.69
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.66
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.6
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.59
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.59
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.58
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.57
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.56
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.56
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.55
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.52
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.51
3uqc_A 286 Probable conserved transmembrane protein; structur 99.45
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.44
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.43
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.42
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.42
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.42
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.42
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.41
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.41
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.41
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.4
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.4
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.4
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.39
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.38
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.38
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.37
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.37
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.37
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.36
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.36
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.35
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.34
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.34
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.33
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.33
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.33
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.33
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.33
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.33
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.32
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.32
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.32
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.32
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.32
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.32
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.32
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.32
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.31
3niz_A 311 Rhodanese family protein; structural genomics, str 99.31
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.31
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.31
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.31
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.3
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.3
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.3
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.3
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.3
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.3
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.3
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.3
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.29
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.29
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.29
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.29
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.29
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.28
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.28
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.28
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.28
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.28
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.28
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.28
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.26
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.26
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.26
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.25
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.25
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.25
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.25
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.25
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.25
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.25
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.24
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.24
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.24
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.23
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.23
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.23
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.22
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.22
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.22
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.22
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.22
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.22
3bhy_A 283 Death-associated protein kinase 3; death associate 99.22
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.22
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.22
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.21
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.21
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.21
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.21
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.21
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.21
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.21
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.21
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.21
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.21
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.21
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.21
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.21
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.2
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.2
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.2
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.2
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.19
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.19
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.19
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.19
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.19
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.18
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.18
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.18
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.18
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.18
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.18
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.18
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.17
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.17
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.17
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.17
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.17
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.17
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.17
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.16
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.16
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.16
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.16
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.16
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.15
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.15
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.15
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.15
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.15
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.14
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.14
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.14
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.14
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.14
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.14
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.14
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.14
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.14
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.14
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.13
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.13
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.13
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.13
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.13
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.12
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.12
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.12
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.12
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.12
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.12
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.12
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.11
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.11
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.11
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.11
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.1
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.1
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.09
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.08
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.08
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.08
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.08
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.08
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.08
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.07
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.07
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.06
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.06
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.06
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.06
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.05
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.05
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.05
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.05
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.05
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.05
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.05
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.05
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.04
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.04
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.04
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.04
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.03
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.02
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.02
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.02
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.02
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.01
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.01
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.01
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.0
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.0
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.0
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.0
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.0
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.0
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 98.99
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 98.99
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 98.97
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 98.96
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 98.96
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 98.96
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 98.95
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.94
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 98.94
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 98.94
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 98.94
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 98.93
3q4u_A 301 Activin receptor type-1; structural genomics conso 98.93
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 98.9
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 98.9
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 98.9
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 98.9
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 98.87
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 98.87
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 98.87
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 98.86
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.86
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 98.86
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 98.85
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 98.85
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 98.84
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 98.82
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 98.81
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 98.8
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 98.8
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 98.79
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 98.73
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 98.69
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.45
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 98.38
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 98.33
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 98.26
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 97.82
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 97.66
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 96.75
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 94.09
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 94.02
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 93.68
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 89.46
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 87.56
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 86.4
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=99.74  E-value=2.5e-18  Score=132.98  Aligned_cols=82  Identities=38%  Similarity=0.613  Sum_probs=73.4

Q ss_pred             CCCCCCeEEEeeeccCCCeeEEEEEEeCCCCCeEEEEeeecccccccchhhhHHHHHHHHHHhcCCCCccccceeEEeCC
Q psy1646          95 KVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKV  174 (178)
Q Consensus        95 ~~~~~~~~~~~~lG~G~fg~V~~~~~~~~~~~~~aiK~i~~~~~~~~~~~~~~~~Ei~il~~l~~hp~iv~l~~~~~~~~  174 (178)
                      ....++|+++++||+|+||+||+|.++.+ ++.||||+|++..+........+.+|+.+|..| +|||||+++++|++.+
T Consensus        28 ~~~~~dy~i~~~lG~G~fg~V~~a~~~~~-~~~~AiK~i~k~~~~~~~~~~~~~~E~~il~~l-~HpnIv~l~~~~~~~~  105 (311)
T 4aw0_A           28 KKRPEDFKFGKILGEGSFSTVVLARELAT-SREYAIKILEKRHIIKENKVPYVTRERDVMSRL-DHPFFVKLYFTFQDDE  105 (311)
T ss_dssp             CCCGGGEEEEEEEEEETTEEEEEEEETTT-CCEEEEEEEEHHHHHHTTCHHHHHHHHHHHTTC-CCTTBCCEEEEEECSS
T ss_pred             CCCccccEEEEEEecccCeEEEEEEECCC-CCEEEEEEEEHHHCCCHHHHHHHHHHHHHHHhC-CCCCCCeEEEEEEeCC
Confidence            44567899999999999999999999999 999999999876554455677899999999999 9999999999999999


Q ss_pred             eEeC
Q psy1646         175 KCSF  178 (178)
Q Consensus       175 ~~yl  178 (178)
                      ++||
T Consensus       106 ~~yi  109 (311)
T 4aw0_A          106 KLYF  109 (311)
T ss_dssp             EEEE
T ss_pred             EEEE
Confidence            9886



>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 7e-21
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-18
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-18
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-18
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-17
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-16
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 6e-16
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-15
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-15
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-14
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-14
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-14
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-14
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 3e-14
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 5e-14
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-14
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 7e-14
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-13
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-13
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-13
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-13
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-13
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-13
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 4e-13
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-13
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 5e-13
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 6e-13
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 7e-13
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-13
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 9e-13
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 9e-13
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-12
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-12
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-12
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-12
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 4e-12
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-12
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 6e-12
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 6e-12
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 7e-12
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 8e-12
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-11
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-11
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 2e-11
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-11
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-11
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-11
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-11
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 5e-11
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 5e-11
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 6e-11
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-10
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-10
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 3e-10
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-10
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-10
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-10
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-10
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 8e-10
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-09
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 8e-09
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 5e-08
d1zara2 191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 8e-04
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase C, theta type
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 85.2 bits (210), Expect = 7e-21
 Identities = 45/76 (59%), Positives = 60/76 (78%), Gaps = 1/76 (1%)

Query: 98  LEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALA 157
           +EDF   K+LGKGSFGKV LAE +  +++ +A+K LKKDV++ DDDV+CTM EKR+L+LA
Sbjct: 1   IEDFILHKMLGKGSFGKVFLAEFK-KTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLA 59

Query: 158 AKHPFLTALHSCFQTK 173
            +HPFLT +   FQTK
Sbjct: 60  WEHPFLTHMFCTFQTK 75


>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.68
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.67
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.66
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.64
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.64
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.63
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.63
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.62
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.62
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.61
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.61
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.61
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.6
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.59
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.59
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.59
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.58
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.58
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.58
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.56
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.55
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.55
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.53
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.52
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.52
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.52
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.52
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.51
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.51
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.5
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.5
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.5
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.49
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.47
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.46
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.46
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.45
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.45
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.45
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.45
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.44
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.44
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.43
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.43
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.42
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.41
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.41
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.4
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.39
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.39
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.38
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.37
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.36
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.34
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.29
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.28
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.24
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.15
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.14
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.13
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.42
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 85.99
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: 3-phosphoinositide dependent protein kinase-1 Pdk1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=4.2e-17  Score=123.22  Aligned_cols=83  Identities=39%  Similarity=0.624  Sum_probs=72.6

Q ss_pred             CCCCCCCeEEEeeeccCCCeeEEEEEEeCCCCCeEEEEeeecccccccchhhhHHHHHHHHHHhcCCCCccccceeEEeC
Q psy1646          94 RKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTK  173 (178)
Q Consensus        94 ~~~~~~~~~~~~~lG~G~fg~V~~~~~~~~~~~~~aiK~i~~~~~~~~~~~~~~~~Ei~il~~l~~hp~iv~l~~~~~~~  173 (178)
                      .....++|+++++||+|+||.||+|.++.+ +..||||++.+...........+.+|+.+|+.+ +|||||+++++|.+.
T Consensus         3 ~~~~p~dy~i~~~lG~G~fg~Vy~a~~~~~-~~~vAvK~i~~~~~~~~~~~~~~~~E~~il~~l-~HpnIv~l~~~~~~~   80 (288)
T d1uu3a_           3 RKKRPEDFKFGKILGEGSFSTVVLARELAT-SREYAIKILEKRHIIKENKVPYVTRERDVMSRL-DHPFFVKLYFTFQDD   80 (288)
T ss_dssp             CCCCGGGEEEEEEEEECSSCEEEEEEETTT-CCEEEEEEEEHHHHHHTTCHHHHHHHHHHHHHC-CSTTBCCEEEEEECS
T ss_pred             CCCCCCCCEEEEEEeeCCCeEEEEEEECCC-CCEEEEEEEehHHccCHHHHHHHHHHHHHHHHc-CCCCeeEEEEEEEEC
Confidence            344557899999999999999999999989 999999999865443445567899999999999 999999999999999


Q ss_pred             CeEeC
Q psy1646         174 VKCSF  178 (178)
Q Consensus       174 ~~~yl  178 (178)
                      +.+||
T Consensus        81 ~~~~i   85 (288)
T d1uu3a_          81 EKLYF   85 (288)
T ss_dssp             SEEEE
T ss_pred             CEEEE
Confidence            98875



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure