Diaphorina citri psyllid: psy1646


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MNGEMVDLSRGLKSDGLEEEWDDDIKKSATEGKQTQRDTRGPRRHKKEYISSINKGARSATPCTTPRSPRERAARPYTKTSGGGSGRGSSGGDRKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEECcccccEEEEEEECcccccEEEEEEEEccccccccccHHHHHHHHHHHHcccccEEccccccccccccccc
*********RGLKS*********************************************************************************VGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGEMVDLSRGLKSDGLEEEWDDDIKKSATEGKQTQRDTRGPRRHKKEYISSINKGARSATPCTTPRSPRERAARPYTKTSGGGSGRGSSGGDRKVGLEDFHFIKVLGKGSFGKVMLAEKRGSSDEVYAVKVLKKDVIIQDDDVDCTMTEKRILALAAKHPFLTALHSCFQTKVKCSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein kinase C epsilon type Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin-dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblasts. Phosphorylates MARCKS, which phosphorylates and activates PTK2/FAK, leading to the spread of cardiomyocytes. Involved in the control of the directional transport of ITGB1 in mesenchymal cells by phosphorylating vimentin (VIM), an intermediate filament (IF) protein. In epithelial cells, associates with and phosphorylates keratin-8 (KRT8), which induces targeting of desmoplakin at desmosomes and regulates cell-cell contact. Phosphorylates IQGAP1, which binds to CDC42, mediating epithelial cell-cell detachment prior to migration. During cytokinesis, forms a complex with YWHAB, which is crucial for daughter cell separation, and facilitates abscission by a mechanism which may implicate the regulation of RHOA. In cardiac myocytes, regulates myofilament function and excitation coupling at the Z-lines, where it is indirectly associated with F-actin via interaction with COPB1. During endothelin-induced cardiomyocyte hypertrophy, mediates activation of PTK2/FAK, which is critical for cardiomyocyte survival and regulation of sarcomere length. Plays a role in the pathogenesis of dilated cardiomyopathy via persistent phosphorylation of troponin I (TNNI3). Involved in nerve growth factor (NFG)-induced neurite outgrowth and neuron morphological change independently of its kinase activity, by inhibition of RHOA pathway, activation of CDC42 and cytoskeletal rearrangement. May be involved in presynaptic facilitation by mediating phorbol ester-induced synaptic potentiation. Phosphorylates gamma-aminobutyric acid receptor subunit gamma-2 (GABRG2), which reduces the response of GABA receptors to ethanol and benzodiazepines and may mediate acute tolerance to the intoxicating effects of ethanol. Upon PMA treatment, phosphorylates the capsaicin- and heat-activated cation channel TRPV1, which is required for bradykinin-induced sensitization of the heat response in nociceptive neurons. Is able to form a complex with PDLIM5 and N-type calcium channel, and may enhance channel activities and potentiates fast synaptic transmission by phosphorylating the pore-forming alpha subunit CACNA1B (CaV2.2). Downstream of TLR4, plays an important role in the lipopolysaccharide (LPS)-induced immune response by phosphorylating and activating TICAM2/TRAM, which in turn activates the transcription factor IRF3 and subsequent cytokines production. In differentiating erythroid progenitors, is regulated by EPO and controls the protection against the TNFSF10/TRAIL-mediated apoptosis, via BCL2. May be involved in the regulation of the insulin-induced phosphorylation and activation of AKT1.confidentP10830
Protein kinase C epsilon type Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin-dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblasts. Phosphorylates MARCKS, which phosphorylates and activates PTK2/FAK, leading to the spread of cardiomyocytes. Involved in the control of the directional transport of ITGB1 in mesenchymal cells by phosphorylating vimentin (VIM), an intermediate filament (IF) protein. In epithelial cells, associates with and phosphorylates keratin-8 (KRT8), which induces targeting of desmoplakin at desmosomes and regulates cell-cell contact. Phosphorylates IQGAP1, which binds to CDC42, mediating epithelial cell-cell detachment prior to migration. In HeLa cells, contributes to hepatocyte growth factor (HGF)-induced cell migration, and in human corneal epithelial cells, plays a critical role in wound healing after activation by HGF. During cytokinesis, forms a complex with YWHAB, which is crucial for daughter cell separation, and facilitates abscission by a mechanism which may implicate the regulation of RHOA. In cardiac myocytes, regulates myofilament function and excitation coupling at the Z-lines, where it is indirectly associated with F-actin via interaction with COPB1. During endothelin-induced cardiomyocyte hypertrophy, mediates activation of PTK2/FAK, which is critical for cardiomyocyte survival and regulation of sarcomere length. Plays a role in the pathogenesis of dilated cardiomyopathy via persistent phosphorylation of troponin I (TNNI3). Involved in nerve growth factor (NFG)-induced neurite outgrowth and neuron morphological change independently of its kinase activity, by inhibition of RHOA pathway, activation of CDC42 and cytoskeletal rearrangement. May be involved in presynaptic facilitation by mediating phorbol ester-induced synaptic potentiation. Phosphorylates gamma-aminobutyric acid receptor subunit gamma-2 (GABRG2), which reduces the response of GABA receptors to ethanol and benzodiazepines and may mediate acute tolerance to the intoxicating effects of ethanol. Upon PMA treatment, phosphorylates the capsaicin- and heat-activated cation channel TRPV1, which is required for bradykinin-induced sensitization of the heat response in nociceptive neurons. Is able to form a complex with PDLIM5 and N-type calcium channel, and may enhance channel activities and potentiates fast synaptic transmission by phosphorylating the pore-forming alpha subunit CACNA1B (CaV2.2). In prostate cancer cells, interacts with and phosphorylates STAT3, which increases DNA-binding and transcriptional activity of STAT3 and seems to be essential for prostate cancer cell invasion. Downstream of TLR4, plays an important role in the lipopolysaccharide (LPS)-induced immune response by phosphorylating and activating TICAM2/TRAM, which in turn activates the transcription factor IRF3 and subsequent cytokines production. In differentiating erythroid progenitors, is regulated by EPO and controls the protection against the TNFSF10/TRAIL-mediated apoptosis, via BCL2. May be involved in the regulation of the insulin-induced phosphorylation and activation of AKT1.confidentQ02156
Protein kinase C-like confidentQ00078

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034351 [BP]negative regulation of glial cell apoptotic processprobableGO:0043069, GO:0034350, GO:0050794, GO:0008150, GO:0043067, GO:0043066, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:2000113 [BP]negative regulation of cellular macromolecule biosynthetic processprobableGO:0009889, GO:0010605, GO:0019222, GO:0009890, GO:0031327, GO:0031326, GO:0031323, GO:0031324, GO:2000112, GO:0050794, GO:0050789, GO:0060255, GO:0010556, GO:0065007, GO:0008150, GO:0048519, GO:0009892, GO:0010558, GO:0048523
GO:0007169 [BP]transmembrane receptor protein tyrosine kinase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016363 [CC]nuclear matrixprobableGO:0034399, GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0050796 [BP]regulation of insulin secretionprobableGO:0090087, GO:0032879, GO:0060341, GO:0051046, GO:0002791, GO:0050794, GO:0008150, GO:0090276, GO:0046883, GO:0051049, GO:0023051, GO:0065007, GO:0010646, GO:0050789
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0010613 [BP]positive regulation of cardiac muscle hypertrophyprobableGO:0014742, GO:0010611, GO:0044057, GO:0051240, GO:0014743, GO:0065007, GO:0090257, GO:0051239, GO:0048518, GO:0008150, GO:0043502, GO:0050789
GO:0043434 [BP]response to peptide hormone stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0010033
GO:0042391 [BP]regulation of membrane potentialprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0007190 [BP]activation of adenylate cyclase activityprobableGO:0019220, GO:0031281, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0051339, GO:0045981, GO:0043085, GO:0009893, GO:0030819, GO:0030816, GO:0045761, GO:0045762, GO:0009891, GO:0030810, GO:0050789, GO:0065007, GO:0044093, GO:0051349, GO:0048518, GO:0065009, GO:0045935, GO:0045937, GO:0019219, GO:0050790, GO:0009889, GO:0050794, GO:0051174, GO:1900542, GO:0008150, GO:0051171, GO:0051173, GO:0030799, GO:0031279, GO:1900544, GO:1900371, GO:0030808, GO:0080090, GO:0030804, GO:0030801, GO:1900373, GO:0030802, GO:0030817, GO:0006140, GO:0030814, GO:0010562, GO:0048522
GO:0007194 [BP]negative regulation of adenylate cyclase activityprobableGO:0010563, GO:0031280, GO:0080090, GO:0019222, GO:0031327, GO:0051350, GO:0031324, GO:0031323, GO:0009892, GO:1900371, GO:0045980, GO:0043086, GO:0019220, GO:0009890, GO:0030818, GO:0045761, GO:0030814, GO:0030815, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045934, GO:0045936, GO:0019219, GO:0050790, GO:0009889, GO:0050794, GO:0031326, GO:1900542, GO:0008150, GO:0051171, GO:0051172, GO:0030799, GO:0031279, GO:0051174, GO:1900543, GO:0030802, GO:0030809, GO:0030808, GO:1900372, GO:0030800, GO:0030803, GO:0051339, GO:0030817, GO:0006140, GO:0048523
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0007346 [BP]regulation of mitotic cell cycleprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0051047 [BP]positive regulation of secretionprobableGO:0051046, GO:0051050, GO:0051049, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789
GO:2001031 [BP]positive regulation of cellular glucuronidationprobableGO:0009893, GO:0080090, GO:0031325, GO:0031323, GO:0010565, GO:0050794, GO:2001029, GO:0048518, GO:0065007, GO:0010675, GO:0010676, GO:0045913, GO:0008150, GO:0019222, GO:0006109, GO:0050789, GO:0048522
GO:0001750 [CC]photoreceptor outer segmentprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0031513, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0005622
GO:0010639 [BP]negative regulation of organelle organizationprobableGO:0033043, GO:0009987, GO:0051129, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0044699, GO:0048519, GO:0051128, GO:0050789, GO:0048523
GO:0071902 [BP]positive regulation of protein serine/threonine kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0045860, GO:0071900, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0043410 [BP]positive regulation of MAPK cascadeprobableGO:0023051, GO:0010646, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0050789, GO:0043408
GO:0097190 [BP]apoptotic signaling pathwayprobableGO:0010259, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0006915, GO:0050794, GO:0008150, GO:0012501, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007569, GO:0050789, GO:0044699
GO:0031349 [BP]positive regulation of defense responseprobableGO:0080134, GO:0048584, GO:0048583, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0031347
GO:0006935 [BP]chemotaxisprobableGO:0040011, GO:0042330, GO:0009605, GO:0050896, GO:0008150, GO:0042221
GO:0051051 [BP]negative regulation of transportprobableGO:0051049, GO:0065007, GO:0008150, GO:0048519, GO:0032879, GO:0050789
GO:0043407 [BP]negative regulation of MAP kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0044092, GO:0048585, GO:0031324, GO:0048583, GO:0023057, GO:0043405, GO:0010648, GO:0023051, GO:0009892, GO:0071901, GO:0071900, GO:0010627, GO:0043086, GO:0043409, GO:0043408, GO:0051248, GO:0010646, GO:0010605, GO:0009968, GO:0009966, GO:0051348, GO:0051246, GO:0050789, GO:0065007, GO:0031399, GO:0048519, GO:0065009, GO:0010741, GO:0006469, GO:0045936, GO:0060255, GO:0031323, GO:0045859, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0032269, GO:0042326, GO:0050790, GO:0010563, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0046627 [BP]negative regulation of insulin receptor signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0046626, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:1900077, GO:1900076, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0002159 [BP]desmosome assemblyprobableGO:0022607, GO:0034330, GO:0016043, GO:0008150, GO:0044085, GO:0007043, GO:0071840, GO:0045216, GO:0002934, GO:0044763, GO:0009987, GO:0034329, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0050730 [BP]regulation of peptidyl-tyrosine phosphorylationprobableGO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0001932, GO:0050789
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006816 [BP]calcium ion transportprobableGO:0072511, GO:0006812, GO:0006811, GO:0006810, GO:0008150, GO:0044765, GO:0030001, GO:0070838, GO:0051234, GO:0051179, GO:0044699
GO:0046907 [BP]intracellular transportprobableGO:0009987, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0071363 [BP]cellular response to growth factor stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0070848, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0080135 [BP]regulation of cellular response to stressprobableGO:0080134, GO:0048583, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0030838 [BP]positive regulation of actin filament polymerizationprobableGO:0033043, GO:0051128, GO:0008064, GO:0071840, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0051495, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0065008, GO:0051130, GO:0009987, GO:0032970, GO:0031334, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0010638, GO:0044087, GO:0008150, GO:0032535, GO:0048522
GO:0003785 [MF]actin monomer bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0050927 [BP]positive regulation of positive chemotaxisprobableGO:0040012, GO:0032103, GO:0040017, GO:0032101, GO:0048584, GO:0048583, GO:0050795, GO:0050789, GO:0008150, GO:0050926, GO:0050920, GO:0050921, GO:0048518, GO:0065007, GO:0048520
GO:0035403 [MF]histone kinase activity (H3-T6 specific)probableGO:0035184, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0035173, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0035408 [BP]histone H3-T6 phosphorylationprobableGO:0018107, GO:0016310, GO:0018193, GO:0044699, GO:0016043, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018210, GO:0071704, GO:0016570, GO:0016572, GO:0006468, GO:0009987, GO:0006464, GO:0043412, GO:0035405, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0006796, GO:0036211, GO:0006793, GO:0044763, GO:0016568, GO:0016569
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051960 [BP]regulation of nervous system developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0071495 [BP]cellular response to endogenous stimulusprobableGO:0009719, GO:0050896, GO:0008150
GO:0070555 [BP]response to interleukin-1probableGO:0042221, GO:0050896, GO:0008150, GO:0034097, GO:0010033
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0035276 [MF]ethanol bindingprobableGO:0043168, GO:0043178, GO:0043167, GO:0036094, GO:0003674, GO:0005488
GO:0000302 [BP]response to reactive oxygen speciesprobableGO:1901700, GO:0050896, GO:0006950, GO:0008150, GO:0042221, GO:0006979
GO:0045471 [BP]response to ethanolprobableGO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033
GO:0002682 [BP]regulation of immune system processprobableGO:0008150, GO:0065007, GO:0050789
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0004699 [MF]calcium-independent protein kinase C activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672, GO:0004697
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0006874 [BP]cellular calcium ion homeostasisprobableGO:0019725, GO:0072507, GO:0072503, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0045787 [BP]positive regulation of cell cycleprobableGO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045785 [BP]positive regulation of cell adhesionprobableGO:0030155, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0071322 [BP]cellular response to carbohydrate stimulusprobableGO:1901700, GO:1901701, GO:0051716, GO:0009743, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0046324 [BP]regulation of glucose importprobableGO:0051049, GO:0010827, GO:0008150, GO:0065007, GO:0032879, GO:0050789
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0030546 [MF]receptor activator activityprobableGO:0030545, GO:0003674
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0032153 [CC]cell division siteprobableGO:0005575, GO:0044464, GO:0005623
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0044448 [CC]cell cortex partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0043536 [BP]positive regulation of blood vessel endothelial cell migrationprobableGO:0010634, GO:0051272, GO:0030335, GO:0030334, GO:0010595, GO:0010594, GO:0010632, GO:0040017, GO:0040012, GO:0051239, GO:0043535, GO:0051270, GO:2000145, GO:0008150, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0009611 [BP]response to woundingprobableGO:0006950, GO:0008150, GO:0050896
GO:0071456 [BP]cellular response to hypoxiaprobableGO:0009628, GO:0051716, GO:0070887, GO:0036293, GO:0050896, GO:0009987, GO:0071453, GO:0036294, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0001666, GO:0044699, GO:0070482
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0002252 [BP]immune effector processprobableGO:0002376, GO:0008150
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0050996 [BP]positive regulation of lipid catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0019222, GO:0019216, GO:0050994, GO:0008150, GO:0045834, GO:0048518, GO:0065007, GO:0050789, GO:0080090
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0002062 [BP]chondrocyte differentiationprobableGO:0032502, GO:0051216, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0009888, GO:0061448, GO:0008150, GO:0001501, GO:0048513, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0048856
GO:0044708 [BP]single-organism behaviorprobableGO:0050896, GO:0008150, GO:0007610
GO:0051336 [BP]regulation of hydrolase activityprobableGO:0019222, GO:0050790, GO:0008150, GO:0065007, GO:0065009, GO:0050789
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0002274 [BP]myeloid leukocyte activationprobableGO:0009987, GO:0002376, GO:0045321, GO:0001775, GO:0044763, GO:0008150, GO:0044699
GO:0006955 [BP]immune responseprobableGO:0002376, GO:0050896, GO:0008150
GO:0043269 [BP]regulation of ion transportprobableGO:0008150, GO:0051049, GO:0032879, GO:0065007, GO:0050789
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0090330 [BP]regulation of platelet aggregationprobableGO:0034110, GO:0050865, GO:0030155, GO:0032101, GO:0048583, GO:1900046, GO:0050794, GO:0050789, GO:0022407, GO:0061041, GO:0065007, GO:0010543, GO:0051239, GO:0030193, GO:0008150, GO:0050818, GO:0080134

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TXO, chain A
Confidence level:very confident
Coverage over the Query: 99-178
View the alignment between query and template
View the model in PyMOL