Diaphorina citri psyllid: psy16471


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MSAMEVDTEENVELPTSSTTKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
ccccccccccccccccccccccccccEEEEEEEEEEEEEEcccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccHHHHccccccccccccCECcccccHHHHHHHHHHHHcccccccccccccEEccccc
**************************FDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAMEVDTEENVELPTSSTTKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase RBX1 E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. The functional specificity of the E3 ubiquitin-protein ligase complexes depends on the variable substrate recognition components. As a component of the CSA complex promotes the ubiquitination of ERCC6 resulting in proteasomal degradation (By similarity). Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme, like CDC34, to the complex and brings it into close proximity to the substrate. Probably also stimulates CDC34 autoubiquitination. May be required for histone H3 and histone H4 ubiquitination in response to ultraviolet and for subsequent DNA repair. Promotes the neddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction with UBE2M.confidentP62878
RING-box protein pip1 Component of E3 ubiquitin ligase SCF complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recruit the E2 ubiquitination enzyme, like UBC3/CDC34, to the complex and brings it into close proximity to the substrate. Component of the rik1-associated E3 ubiquitin ligase complex that shows ubiquitin ligase activity and is required for histone H3K9 methylation. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting swi6/HP1 to methylated histones which leads to transcriptional silencing within centromeric heterochromatin, telomeric regions and at the silent mating-type loci.confidentO13959
RING-box protein 1 Component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate.confidentQ54K33

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000151 [CC]ubiquitin ligase complexconfidentGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016567 [BP]protein ubiquitinationconfidentGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0030891 [CC]VCB complexprobableGO:0005737, GO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0000153, GO:0005575, GO:0044444, GO:0044424, GO:0005622
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0009733 [BP]response to auxin stimulusprobableGO:0009719, GO:0009725, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0019915 [BP]lipid storageprobableGO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0031463 [CC]Cul3-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0031464 [CC]Cul4A-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0080008, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0031465 [CC]Cul4B-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0080008, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0031466 [CC]Cul5-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006513 [BP]protein monoubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0019005 [CC]SCF ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0045116 [BP]protein neddylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0019788 [MF]NEDD8 ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0031462 [CC]Cul2-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0051788 [BP]response to misfolded proteinprobableGO:0050896, GO:0006950, GO:0035966, GO:0008150, GO:0042221, GO:0010033
GO:0008637 [BP]apoptotic mitochondrial changesprobableGO:0006996, GO:0010259, GO:0009987, GO:0071840, GO:0006915, GO:0016043, GO:0012501, GO:0044763, GO:0044699, GO:0008150, GO:0007569, GO:0007005
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0042023 [BP]DNA endoreduplicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0022402, GO:0034645, GO:0044699, GO:1901576, GO:0044260, GO:1901360, GO:0071704, GO:0006260, GO:0006261, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0007049, GO:0044237, GO:0043170, GO:0006259, GO:0044763, GO:0044786
GO:0051759 [BP]sister chromosome movement towards spindle pole involved in meiotic sister chromatid segregationprobableGO:0048610, GO:0006928, GO:0022402, GO:0051305, GO:0051656, GO:0051303, GO:0044699, GO:0007126, GO:0051321, GO:0000003, GO:0071840, GO:0045132, GO:0016043, GO:0007049, GO:0051641, GO:0016344, GO:0009987, GO:0044763, GO:0051649, GO:0007059, GO:0051234, GO:0045144, GO:0051179, GO:0007135, GO:0051276, GO:0006996, GO:0007017, GO:0000819, GO:0070192, GO:0007018, GO:0050000, GO:0051640, GO:0008150
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0035046 [BP]pronuclear migrationprobableGO:0044699, GO:0051656, GO:0000003, GO:0051234, GO:0040023, GO:0009987, GO:0009566, GO:0019953, GO:0008150, GO:0022414, GO:0044702, GO:0044763, GO:0007338, GO:0051649, GO:0051647, GO:0007097, GO:0051179, GO:0051640, GO:0051641
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0000278 [BP]mitotic cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0040015 [BP]negative regulation of multicellular organism growthprobableGO:0045926, GO:0040014, GO:0040008, GO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0050789
GO:0030178 [BP]negative regulation of Wnt receptor signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0009853 [BP]photorespirationprobableGO:0043094, GO:0009987, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152
GO:0061418 [BP]regulation of transcription from RNA polymerase II promoter in response to hypoxiaprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0001666, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0043618, GO:0019219, GO:0071453, GO:0010556, GO:0065007, GO:0071456, GO:0043620, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0044763, GO:0051171, GO:2001141, GO:0042221, GO:0070482, GO:0009628, GO:0036293, GO:0050896, GO:0051252, GO:0036294, GO:0006355, GO:0006357, GO:0033554, GO:0008150
GO:0007224 [BP]smoothened signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007138 [BP]meiotic anaphase IIprobableGO:0007126, GO:0048610, GO:0000279, GO:0000003, GO:0051322, GO:0007049, GO:0009987, GO:0044699, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0051321, GO:0007135
GO:0008595 [BP]anterior/posterior axis specification, embryoprobableGO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0009948, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0000578, GO:0009798, GO:0007351, GO:0007350, GO:0035282, GO:0044699, GO:0009880
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0005680 [CC]anaphase-promoting complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0000151, GO:0000152, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0031461, GO:0043227, GO:0043226, GO:0044422
GO:0042752 [BP]regulation of circadian rhythmprobableGO:0008150, GO:0065007, GO:0050789
GO:0051510 [BP]regulation of unidimensional cell growthprobableGO:0022604, GO:0048638, GO:0022603, GO:0050793, GO:0040008, GO:0051128, GO:0001558, GO:0065007, GO:0008150, GO:0050794, GO:0050789
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0006919 [BP]activation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0097202, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0043280, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0008190 [MF]eukaryotic initiation factor 4E bindingprobableGO:0031369, GO:0003674, GO:0005488, GO:0005515
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0008406 [BP]gonad developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0045137, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0080129 [BP]proteasome core complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0043248, GO:0034622, GO:0043623, GO:0071840
GO:0031146 [BP]SCF-dependent proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0016925 [BP]protein sumoylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0008631 [BP]intrinsic apoptotic signaling pathway in response to oxidative stressprobableGO:0097190, GO:0097193, GO:0023052, GO:0007165, GO:0035556, GO:0007569, GO:0050789, GO:0044699, GO:0051716, GO:0065007, GO:0010259, GO:0006915, GO:0009987, GO:0050794, GO:0012501, GO:0006950, GO:0008150, GO:0007154, GO:0006979, GO:0044700, GO:0050896, GO:0044763
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A0K, chain B
Confidence level:very confident
Coverage over the Query: 24-44
View the alignment between query and template
View the model in PyMOL
Template: 3DPL, chain R
Confidence level:very confident
Coverage over the Query: 18-60,73-106
View the alignment between query and template
View the model in PyMOL