Psyllid ID: psy16471
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| 340710468 | 113 | PREDICTED: RING-box protein 1A-like [Bom | 0.725 | 0.982 | 0.677 | 1e-48 | |
| 270005021 | 113 | hypothetical protein TcasGA2_TC007016 [T | 0.725 | 0.982 | 0.671 | 2e-48 | |
| 383853493 | 113 | PREDICTED: RING-box protein 1A-like [Meg | 0.725 | 0.982 | 0.671 | 5e-48 | |
| 332374460 | 113 | unknown [Dendroctonus ponderosae] | 0.725 | 0.982 | 0.664 | 6e-48 | |
| 114052775 | 113 | ring box protein [Bombyx mori] gi|872485 | 0.725 | 0.982 | 0.657 | 1e-46 | |
| 157107043 | 109 | ring finger [Aedes aegypti] gi|94469000| | 0.712 | 1.0 | 0.66 | 1e-46 | |
| 350537579 | 110 | uncharacterized protein LOC100162035 [Ac | 0.712 | 0.990 | 0.675 | 2e-46 | |
| 170054653 | 109 | RING-box protein 1A [Culex quinquefascia | 0.712 | 1.0 | 0.66 | 2e-46 | |
| 58385635 | 109 | AGAP005202-PB [Anopheles gambiae str. PE | 0.712 | 1.0 | 0.653 | 2e-46 | |
| 195469549 | 111 | GE16630 [Drosophila yakuba] gi|194187224 | 0.725 | 1.0 | 0.666 | 3e-46 |
| >gi|340710468|ref|XP_003393810.1| PREDICTED: RING-box protein 1A-like [Bombus terrestris] gi|350427457|ref|XP_003494765.1| PREDICTED: RING-box protein 1A-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 197 bits (502), Expect = 1e-48, Method: Compositional matrix adjust.
Identities = 103/152 (67%), Positives = 109/152 (71%), Gaps = 41/152 (26%)
Query: 2 SAMEVDTEENVELPTSSTTKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC 61
SAME+D EE+ +LPTSS++KGEKKRF+VKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC
Sbjct: 3 SAMEIDDEES-DLPTSSSSKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC 61
Query: 62 QANQASTTSEECTVAWGVCNHAFHFHCISRNHIMDLCIECQANQASTTSEECTVAWGVCN 121
QANQAS TSEECTVAWGVCNHAFHFHCI
Sbjct: 62 QANQASATSEECTVAWGVCNHAFHFHCI-------------------------------- 89
Query: 122 HAFHFHCISRWLKTRQVCPLDNREWEFQKYGH 153
SRWLKTRQVCPLDNREWEFQKYGH
Sbjct: 90 --------SRWLKTRQVCPLDNREWEFQKYGH 113
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270005021|gb|EFA01469.1| hypothetical protein TcasGA2_TC007016 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383853493|ref|XP_003702257.1| PREDICTED: RING-box protein 1A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332374460|gb|AEE62371.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|114052775|ref|NP_001040275.1| ring box protein [Bombyx mori] gi|87248591|gb|ABD36348.1| ring box protein [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|157107043|ref|XP_001649597.1| ring finger [Aedes aegypti] gi|94469000|gb|ABF18349.1| SCF ubiquitin ligase Rbx1 component [Aedes aegypti] gi|108879660|gb|EAT43885.1| AAEL004691-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|350537579|ref|NP_001233108.1| uncharacterized protein LOC100162035 [Acyrthosiphon pisum] gi|239789982|dbj|BAH71582.1| ACYPI003216 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|170054653|ref|XP_001863227.1| RING-box protein 1A [Culex quinquefasciatus] gi|167874914|gb|EDS38297.1| RING-box protein 1A [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|58385635|ref|XP_314102.2| AGAP005202-PB [Anopheles gambiae str. PEST] gi|158292752|ref|XP_001688524.1| AGAP005202-PA [Anopheles gambiae str. PEST] gi|55240588|gb|EAA09407.2| AGAP005202-PB [Anopheles gambiae str. PEST] gi|157017140|gb|EDO64107.1| AGAP005202-PA [Anopheles gambiae str. PEST] gi|312379673|gb|EFR25873.1| hypothetical protein AND_26478 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|195469549|ref|XP_002099700.1| GE16630 [Drosophila yakuba] gi|194187224|gb|EDX00808.1| GE16630 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| TAIR|locus:2149927 | 142 | RBX1 "RING-box 1" [Arabidopsis | 0.830 | 0.894 | 0.636 | 9.1e-45 | |
| FB|FBgn0025638 | 108 | Roc1a "Roc1a" [Drosophila mela | 0.562 | 0.796 | 0.875 | 3.3e-40 | |
| UNIPROTKB|Q8QG64 | 108 | rbx1 "RING-box protein 1" [Sal | 0.549 | 0.777 | 0.8 | 2.4e-37 | |
| ZFIN|ZDB-GENE-041008-106 | 122 | rbx1 "ring-box 1" [Danio rerio | 0.549 | 0.688 | 0.8 | 3e-37 | |
| UNIPROTKB|Q2HJI9 | 108 | RBX1 "Uncharacterized protein" | 0.549 | 0.777 | 0.8 | 4.9e-37 | |
| UNIPROTKB|P62877 | 108 | RBX1 "E3 ubiquitin-protein lig | 0.549 | 0.777 | 0.8 | 4.9e-37 | |
| MGI|MGI:1891829 | 108 | Rbx1 "ring-box 1" [Mus musculu | 0.549 | 0.777 | 0.8 | 4.9e-37 | |
| RGD|1308453 | 108 | Rbx1 "ring-box 1, E3 ubiquitin | 0.549 | 0.777 | 0.8 | 4.9e-37 | |
| UNIPROTKB|E1BSR9 | 105 | RBX1 "Uncharacterized protein" | 0.549 | 0.8 | 0.8 | 4.9e-37 | |
| UNIPROTKB|E1BL52 | 108 | LOC780968 "Uncharacterized pro | 0.549 | 0.777 | 0.788 | 1.7e-36 |
| TAIR|locus:2149927 RBX1 "RING-box 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 471 (170.9 bits), Expect = 9.1e-45, P = 9.1e-45
Identities = 93/146 (63%), Positives = 105/146 (71%)
Query: 9 EENVELPTSSTTKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQAST 68
E + + SS+ K + KRF++KKW+AVALWAWDIVVDNCAICRNHIMDLCIECQANQAS
Sbjct: 15 EASSSVAASSSNK-KAKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASA 73
Query: 69 TSEECTVAW-GVCNHAFHFHCISRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFH 127
TSEECTVAW N+ + CI ++C S + GVCNHAFHFH
Sbjct: 74 TSEECTVAWEDDQNNCNKYFCI---------LDC-----SMKDDHLE---GVCNHAFHFH 116
Query: 128 CISRWLKTRQVCPLDNREWEFQKYGH 153
CISRWLKTRQVCPLDN EWEFQKYGH
Sbjct: 117 CISRWLKTRQVCPLDNSEWEFQKYGH 142
|
|
| FB|FBgn0025638 Roc1a "Roc1a" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8QG64 rbx1 "RING-box protein 1" [Salmo salar (taxid:8030)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041008-106 rbx1 "ring-box 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2HJI9 RBX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62877 RBX1 "E3 ubiquitin-protein ligase RBX1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1891829 Rbx1 "ring-box 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308453 Rbx1 "ring-box 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BSR9 RBX1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BL52 LOC780968 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 6e-36 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 2e-29 | |
| pfam12861 | 85 | pfam12861, zf-Apc11, Anaphase-promoting complex su | 2e-08 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 0.001 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 0.002 |
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 119 bits (299), Expect = 6e-36
Identities = 52/129 (40%), Positives = 60/129 (46%), Gaps = 42/129 (32%)
Query: 25 KRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASTTSEECTVAWGVCNHAF 84
+ +KKW+AVALW+WDI +D CAICRNHIM C ECQ
Sbjct: 1 MKVKIKKWHAVALWSWDIPIDVCAICRNHIMGTCPECQFG-------------------- 40
Query: 85 HFHCISRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNR 144
T +EC V WGVCNHAFH HCI RWL T+ VCPLD +
Sbjct: 41 ----------------------MTPGDECPVVWGVCNHAFHDHCIYRWLDTKGVCPLDRQ 78
Query: 145 EWEFQKYGH 153
W G
Sbjct: 79 TWVLADGGA 87
|
Length = 88 |
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| KOG2930|consensus | 114 | 100.0 | ||
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 100.0 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 99.95 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.93 | |
| KOG1493|consensus | 84 | 99.93 | ||
| KOG2930|consensus | 114 | 99.68 | ||
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 99.56 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 99.52 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.47 | |
| KOG1493|consensus | 84 | 99.28 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.16 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.03 | |
| KOG4628|consensus | 348 | 98.98 | ||
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.92 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.91 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.8 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.68 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.63 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.62 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.61 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.59 | |
| KOG0802|consensus | 543 | 98.57 | ||
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.53 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.53 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.44 | |
| KOG0317|consensus | 293 | 98.44 | ||
| KOG0320|consensus | 187 | 98.44 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.41 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.36 | |
| KOG4628|consensus | 348 | 98.13 | ||
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.06 | |
| KOG1734|consensus | 328 | 98.03 | ||
| KOG0827|consensus | 465 | 98.01 | ||
| KOG0823|consensus | 230 | 97.98 | ||
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.94 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.87 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.86 | |
| KOG0828|consensus | 636 | 97.8 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 97.69 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.61 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.57 | |
| KOG2164|consensus | 513 | 97.55 | ||
| KOG0804|consensus | 493 | 97.49 | ||
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.47 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.4 | |
| KOG0287|consensus | 442 | 97.4 | ||
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.35 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 97.28 | |
| KOG0825|consensus | 1134 | 97.25 | ||
| KOG3970|consensus | 299 | 97.21 | ||
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 97.15 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.09 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.01 | |
| KOG0978|consensus | 698 | 96.95 | ||
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 96.89 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 96.86 | |
| KOG2177|consensus | 386 | 96.84 | ||
| KOG1645|consensus | 463 | 96.75 | ||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.73 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.57 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 96.49 | |
| KOG1039|consensus | 344 | 96.48 | ||
| KOG4445|consensus | 368 | 96.29 | ||
| KOG1941|consensus | 518 | 96.19 | ||
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 96.15 | |
| KOG0827|consensus | 465 | 95.86 | ||
| KOG0824|consensus | 324 | 95.8 | ||
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 95.62 | |
| KOG4172|consensus | 62 | 95.58 | ||
| KOG0802|consensus | 543 | 95.54 | ||
| KOG0297|consensus | 391 | 95.41 | ||
| KOG0804|consensus | 493 | 95.32 | ||
| KOG0311|consensus | 381 | 95.23 | ||
| KOG0309|consensus | 1081 | 95.2 | ||
| KOG2114|consensus | 933 | 95.16 | ||
| KOG4265|consensus | 349 | 95.1 | ||
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 95.07 | |
| KOG0823|consensus | 230 | 94.96 | ||
| KOG3268|consensus | 234 | 94.82 | ||
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 94.76 | |
| PHA02862 | 156 | 5L protein; Provisional | 94.73 | |
| KOG4185|consensus | 296 | 94.65 | ||
| KOG1734|consensus | 328 | 94.48 | ||
| KOG2660|consensus | 331 | 94.48 | ||
| KOG1940|consensus | 276 | 94.45 | ||
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 94.22 | |
| KOG0317|consensus | 293 | 93.88 | ||
| KOG1952|consensus | 950 | 93.87 | ||
| KOG1428|consensus | 3738 | 93.64 | ||
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 93.56 | |
| KOG1785|consensus | 563 | 93.29 | ||
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 93.19 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 93.17 | |
| KOG1813|consensus | 313 | 92.9 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 92.84 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 92.83 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 92.52 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 92.46 | |
| KOG0825|consensus | 1134 | 92.1 | ||
| KOG3039|consensus | 303 | 90.73 | ||
| KOG2879|consensus | 298 | 90.72 | ||
| KOG0320|consensus | 187 | 90.12 | ||
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 89.78 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 89.67 | |
| KOG4159|consensus | 398 | 89.39 | ||
| PHA03096 | 284 | p28-like protein; Provisional | 88.89 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 88.63 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.62 | |
| KOG2034|consensus | 911 | 88.32 | ||
| KOG1002|consensus | 791 | 87.24 | ||
| KOG2164|consensus | 513 | 87.14 | ||
| KOG4739|consensus | 233 | 86.98 | ||
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 86.95 | |
| KOG0828|consensus | 636 | 86.89 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 86.73 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 86.01 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 84.77 | |
| PF13901 | 202 | DUF4206: Domain of unknown function (DUF4206) | 83.41 | |
| KOG2114|consensus | 933 | 83.4 | ||
| KOG1571|consensus | 355 | 82.68 | ||
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 82.49 | |
| KOG2817|consensus | 394 | 81.48 | ||
| KOG1428|consensus | 3738 | 80.87 |
| >KOG2930|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-39 Score=230.75 Aligned_cols=95 Identities=88% Similarity=1.663 Sum_probs=85.7
Q ss_pred CCCccccceEEEEEEEeEEeeeecccCccccccccccccchhhhhcCCCCCCccccceeccccccceeeeecccccccCc
Q psy16471 18 STTKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRNHIMDL 97 (153)
Q Consensus 18 ~~~~~~~~~~~vk~w~~va~w~wd~~~d~C~IC~~~~~d~c~~C~~~~~~~~~~~c~~~~g~C~H~fh~~c~~~w~~~~~ 97 (153)
++....+++|.||+|++||.|.||+..|+|+|||+.++|+||+||+++ ..++++|
T Consensus 20 ~s~~~~~krF~lKKWnAvAlWaWDi~vDnCAICRnHIMd~CieCQa~~-~~~~~EC------------------------ 74 (114)
T KOG2930|consen 20 SSNEGGKKRFELKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ-SATSEEC------------------------ 74 (114)
T ss_pred ccCCCCCcceEEeeeeeeeeeeeeeeechhHHHHHHHHHHHHhhccCC-CCCCCce------------------------
Confidence 334455999999999999999999999999999999999999999986 5666666
Q ss_pred cccccccccCCCCccceEEeeeecceechHHHHHHHcCCCCCCCCCCCccccccCC
Q psy16471 98 CIECQANQASTTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH 153 (153)
Q Consensus 98 CpiC~~~~~~~~~~~c~~~~~~C~H~FH~~CI~~Wl~~~~~CP~Cr~~w~~~~~~~ 153 (153)
.+++|.|+|.||+|||.+||++++.||+|.++|.||+||+
T Consensus 75 ----------------~VaWG~CNHaFH~hCisrWlktr~vCPLdn~eW~~qr~g~ 114 (114)
T KOG2930|consen 75 ----------------TVAWGVCNHAFHFHCISRWLKTRNVCPLDNKEWVFQRYGH 114 (114)
T ss_pred ----------------EEEeeecchHHHHHHHHHHHhhcCcCCCcCcceeEeecCC
Confidence 5666678899999999999999999999999999999996
|
|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG4445|consensus | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >KOG3268|consensus | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >KOG1940|consensus | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >KOG1952|consensus | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2034|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PF13901 DUF4206: Domain of unknown function (DUF4206) | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 153 | ||||
| 1u6g_B | 108 | Crystal Structure Of The Cand1-Cul1-Roc1 Complex Le | 9e-46 | ||
| 3dpl_R | 106 | Structural Insights Into Nedd8 Activation Of Cullin | 3e-45 | ||
| 3dqv_R | 106 | Structural Insights Into Nedd8 Activation Of Cullin | 2e-44 | ||
| 4a0k_B | 117 | Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp | 1e-43 | ||
| 4a0c_D | 98 | Structure Of The Cand1-Cul4b-Rbx1 Complex Length = | 4e-43 | ||
| 1ldj_B | 90 | Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiqu | 1e-42 | ||
| 2lgv_A | 100 | Rbx1 Length = 100 | 4e-39 | ||
| 2ecl_A | 81 | Solution Structure Of The Ring Domain Of The Human | 4e-10 |
| >pdb|1U6G|B Chain B, Crystal Structure Of The Cand1-Cul1-Roc1 Complex Length = 108 | Back alignment and structure |
|
| >pdb|3DPL|R Chain R, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation. Length = 106 | Back alignment and structure |
| >pdb|3DQV|R Chain R, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 106 | Back alignment and structure |
| >pdb|4A0K|B Chain B, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 117 | Back alignment and structure |
| >pdb|4A0C|D Chain D, Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 98 | Back alignment and structure |
| >pdb|1LDJ|B Chain B, Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiquitin Ligase Complex Length = 90 | Back alignment and structure |
| >pdb|2LGV|A Chain A, Rbx1 Length = 100 | Back alignment and structure |
| >pdb|2ECL|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring-Box Protein 2 Length = 81 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 5e-30 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 1e-29 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 1e-26 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 1e-05 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 1e-05 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 4e-05 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 6e-05 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 1e-04 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 1e-04 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 1e-04 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 1e-04 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 2e-04 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 2e-04 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 2e-04 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 2e-04 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 2e-04 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 4e-04 |
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
Score = 104 bits (259), Expect = 5e-30
Identities = 93/152 (61%), Positives = 99/152 (65%), Gaps = 46/152 (30%)
Query: 2 SAMEVDTEENVELPTSSTTKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC 61
+M+VDT P+ + + KKRF+VKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC
Sbjct: 1 GSMDVDT------PSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC 54
Query: 62 QANQASTTSEECTVAWGVCNHAFHFHCISRNHIMDLCIECQANQASTTSEECTVAWGVCN 121
QANQAS TSEECTVAWGVCNHAFH
Sbjct: 55 QANQASATSEECTVAWGVCNHAFH------------------------------------ 78
Query: 122 HAFHFHCISRWLKTRQVCPLDNREWEFQKYGH 153
FHCISRWLKTRQVCPLDNREWEFQKYGH
Sbjct: 79 ----FHCISRWLKTRQVCPLDNREWEFQKYGH 106
|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.97 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.96 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.9 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.7 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.49 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.44 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.43 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 99.41 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.4 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.4 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.39 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.39 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.35 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.35 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.33 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.32 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.3 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.2 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.2 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.18 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.14 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.13 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.13 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.12 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.1 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.1 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.09 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.09 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.08 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.07 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.05 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.04 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.02 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.99 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.99 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.99 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.97 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.96 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.95 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.94 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.91 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.9 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.88 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.88 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.85 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.8 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.79 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.75 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.74 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.69 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.68 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.66 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.65 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.59 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.53 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.52 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.51 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.51 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.5 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.49 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.49 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.47 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.45 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.4 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.39 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.39 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.37 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.37 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.35 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.35 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.33 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 98.3 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.27 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.21 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.15 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.14 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.13 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.09 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.09 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.04 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.01 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.99 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.98 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.94 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 97.92 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 97.89 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.89 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 97.88 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.83 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 97.78 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 97.76 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.74 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 97.73 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 97.67 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.67 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 97.63 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.62 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 97.61 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 97.6 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.55 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 97.55 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.46 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.45 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 97.45 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 97.43 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 97.4 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 97.4 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 97.34 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 97.34 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.32 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 97.29 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 97.26 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 97.24 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 97.21 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 97.12 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 97.06 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 96.92 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 96.9 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 96.38 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 96.36 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 96.36 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.19 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 96.05 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 95.99 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 95.8 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 95.79 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 95.74 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 95.63 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 95.4 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 95.09 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 95.01 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 95.0 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 94.81 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 93.18 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 93.12 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 92.76 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 92.57 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 92.32 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 90.95 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 90.88 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 90.36 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 89.48 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 89.21 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 88.88 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 88.74 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 88.52 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 88.22 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 87.61 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 86.55 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 85.49 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 84.64 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 83.54 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 82.49 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 82.07 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 80.99 |
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
Probab=99.97 E-value=7.5e-31 Score=190.24 Aligned_cols=95 Identities=93% Similarity=1.675 Sum_probs=80.3
Q ss_pred CCccccceEEEEEEEeEEeeeecccCccccccccccccchhhhhcCCCCCCccccceeccccccceeeeecccccccCcc
Q psy16471 19 TTKGEKKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRNHIMDLC 98 (153)
Q Consensus 19 ~~~~~~~~~~vk~w~~va~w~wd~~~d~C~IC~~~~~d~c~~C~~~~~~~~~~~c~~~~g~C~H~fh~~c~~~w~~~~~C 98 (153)
.....+++|+||+|++|+.|+||+.+|+|+||++.|.+.|+.|+.+....+
T Consensus 12 ~~~~~~~r~~ik~~~~v~~w~~d~~~d~CaIC~~~~~~~c~~C~~~~~~~~----------------------------- 62 (106)
T 3dpl_R 12 NSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT----------------------------- 62 (106)
T ss_dssp -----CCSEEEEEEEEEEEEEESSCSCCCSSSCSCTTSCCTTHHHHTTCC------------------------------
T ss_pred ccccccCceeEEEEEEeeEeecCCCCCCCccCChhHhCcCchhhccccccC-----------------------------
Confidence 356788999999999999999999999999999999998888876543333
Q ss_pred ccccccccCCCCccceEEeeeecceechHHHHHHHcCCCCCCCCCCCccccccCC
Q psy16471 99 IECQANQASTTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH 153 (153)
Q Consensus 99 piC~~~~~~~~~~~c~~~~~~C~H~FH~~CI~~Wl~~~~~CP~Cr~~w~~~~~~~ 153 (153)
++++.+++++|+|.||.+||.+||+++.+||+||++|.|+++||
T Consensus 63 -----------~~~~~~~~~~C~H~FH~~Ci~~Wl~~~~~CP~Cr~~~~~~~~g~ 106 (106)
T 3dpl_R 63 -----------SEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH 106 (106)
T ss_dssp -------------CCCEEEETTSCEEEHHHHHHHHTTCSBCSSSCSBCCEEECCC
T ss_pred -----------CccceEeecccCcEECHHHHHHHHHcCCcCcCCCCcceeecCCC
Confidence 34458899999999999999999999999999999999999997
|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 153 | ||||
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 1e-22 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 2e-04 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 4e-04 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-04 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 8e-04 |
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex species: Human (Homo sapiens) [TaxId: 9606]
Score = 83.6 bits (206), Expect = 1e-22
Identities = 86/128 (67%), Positives = 87/128 (67%), Gaps = 40/128 (31%)
Query: 24 KKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASTTSEECTVAWGVCNHA 83
KKRF+VKKWNAVALWAWDIVVDNCAIC
Sbjct: 1 KKRFEVKKWNAVALWAWDIVVDNCAIC--------------------------------- 27
Query: 84 FHFHCISRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN 143
RNHIMDLCIECQANQAS TSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN
Sbjct: 28 -------RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN 80
Query: 144 REWEFQKY 151
REWEFQKY
Sbjct: 81 REWEFQKY 88
|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.96 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.51 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.51 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.47 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.35 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.28 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.23 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.21 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.94 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.9 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.88 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.85 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.8 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.66 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.55 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.53 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.46 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.37 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.3 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.07 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 97.86 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.75 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 97.74 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.34 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.32 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.25 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 97.07 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 96.74 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 96.62 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 96.09 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 96.06 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 94.51 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 94.01 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 86.71 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 85.63 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 83.48 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 82.76 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 80.27 |
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=2.1e-29 Score=174.76 Aligned_cols=88 Identities=98% Similarity=1.758 Sum_probs=76.0
Q ss_pred cceEEEEEEEeEEeeeecccCccccccccccccchhhhhcCCCCCCccccceeccccccceeeeecccccccCccccccc
Q psy16471 24 KKRFDVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASTTSEECTVAWGVCNHAFHFHCISRNHIMDLCIECQA 103 (153)
Q Consensus 24 ~~~~~vk~w~~va~w~wd~~~d~C~IC~~~~~d~c~~C~~~~~~~~~~~c~~~~g~C~H~fh~~c~~~w~~~~~CpiC~~ 103 (153)
+++|+||+|++|+.|+||..+|.|+||++++.++++.|..+....+.
T Consensus 1 ~~~~~ik~~~av~~w~~d~~~d~C~IC~~~~~~~~~~~~~~~~~~~~--------------------------------- 47 (88)
T d3dplr1 1 KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATS--------------------------------- 47 (88)
T ss_dssp CCSEEEEEEEEEEEEEESSCSCCCSSSCSCTTSCCTTHHHHTTCC-----------------------------------
T ss_pred CCceEEeeEEEEEEEeecCCCCcCEEccchhhCcccccccccccccc---------------------------------
Confidence 47899999999999999999999999999999988887664332222
Q ss_pred cccCCCCccceEEeeeecceechHHHHHHHcCCCCCCCCCCCcccccc
Q psy16471 104 NQASTTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY 151 (153)
Q Consensus 104 ~~~~~~~~~c~~~~~~C~H~FH~~CI~~Wl~~~~~CP~Cr~~w~~~~~ 151 (153)
..+.++.++|||.||.+||.+||+.+++||+||++|.+|||
T Consensus 48 -------~~~~~~~~~C~H~FH~~Ci~~Wl~~~~~CP~CR~~~~~~~~ 88 (88)
T d3dplr1 48 -------EECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY 88 (88)
T ss_dssp --------CCCEEEETTSCEEEHHHHHHHHTTCSBCSSSCSBCCEEEC
T ss_pred -------ccCCeEEccccCcccHHHHHHHHHHCCcCCCCCCccccccC
Confidence 23367889999999999999999999999999999999997
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|