Diaphorina citri psyllid: psy16472

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630

MKLASETESSHRKFSAPRHGSMGFYPKKRSARHRVKKASHRKFSAPRHGSMGFYPKKRSARHRGKVKCFPKDDPTKPVHLTAFIGYKAGMTHIVREADRPGSKINKKEIVEAVTILETPPMVIVGVIGYVETPHGLRSFKTVWAEHLSQECRRRFYKNWYKSRQKAFTKASKKWQDKLGKKTIAQDLRKMAKYCKVIRVIAHTQNQQQSLHQNQQSHTKDQPIQSNVNKTQPDSHESHVQMKLLKKRQKKAHLMEIQLNGGSVADKIAWARQHLEQPIPVGQVFAQDEMIDCIGVTKGKGFKGEMIAMKLLKKRQKKAHLMEIQLNGGSVADKIAWARQHLEQPIPVGQVFAQDEMIDCIGVTKGKGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTELNKKIYRMGAGIHTKDGKVSVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTELFLCKKKYLSMVIKNNASTDYDLTEKSITPMGGFPHYGEVNNDFLMIKGCCMGPKKRVITLRKMKLLKKRQKKAHLMEIQLNGGSVADKIAWARQHLEQPIPVGQVFAQDEMIDCIGVTKGKGFKECVHSNASCAKYFKSLG

cccccccccccccccccccccccCCccccccccccccccccccccccccccccccHHHccccccccccccccccccccEEEEEcccccccEEEEEccccccccccccEEEEEEEEEEccccEEEEEEEEEEcccccEEcEEEEcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHcccccccccEEccccEEEEEEEECcccCEEEEEEEEEEEcccccccEEEEEEcccccHHHHHHHHHHcccccccccccccccEEEEEEEEECccCECcEEccccccccccccccccccccccccccccccccccccccccccEEEEEEcEEEEEccccccccccccccccccCEcccccccccccccccccccccccEEEEEEccccccccccEEEcccEEEEEccccccccccccccccccccccccccCEEEccccEEEEEcccccccEEEEEEEEEEccccccccccEEEEEEEcccHHHHHHHHHHHHccccccccccccccEEEEEEEECcccccCEEEccccccccccccc

**********************************************RHGSMGFYPKKRS**************PTKPVHLTAFIGYKAGMTHIVREADRPGSKINKKEIVEAVTILETPPMVIVGVIGYVETPHGLRSFKTVWAEHLSQECRRRFYKNWYKSRQKA**********KLGKKTIAQDLRKMAKYCKVIRVIAHTQNQQQS**********************PDSHESHVQMKL**K*QKKAHLMEIQLNGGSVADKIAWARQHLEQPIPVGQVFAQDEMIDCIGVTKGKGFKGEMIAMKLLKKRQKKAHLMEIQLNGGSVADKIAWARQHLEQPIPVGQVFAQDEMIDCIGVTKGKGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTELNKKIYRMGAGIHTKDGKVSVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTELFLCKKKYLSMVIKNNASTDYDLTEKSITPMGGFPHYGEVNNDFLMIKGCCMGPKKRVITLRKMKLLKKRQKKAHLMEIQLNGGSVADKIAWARQHLEQPIPVGQVFAQDEMIDCIGVTKGKGFKECVHSNASCAKYFK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L3		confident	Q6FTJ2
60S ribosomal protein L3		confident	Q6BXM5
60S ribosomal protein L3	The L3 protein is a component of the large subunit of cytoplasmic ribosomes.	confident	P27659

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044446 [CC]	intracellular organelle part	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005737 [CC]	cytoplasm	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0022625 [CC]	cytosolic large ribosomal subunit	probable	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071353 [BP]	cellular response to interleukin-4	probable	GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0070670, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0019083 [BP]	viral transcription	probable	GO:0048610, GO:0032774, GO:0019080, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:1901362, GO:1901360, GO:0006139, GO:0000003, GO:0044260, GO:0071704, GO:0019058, GO:0051704, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0022415, GO:0022414, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044703, GO:0044271, GO:0044237, GO:0043170, GO:0044764, GO:0016032, GO:0019438
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0003735 [MF]	structural constituent of ribosome	probable	GO:0003674, GO:0005198
GO:0006415 [BP]	translational termination	probable	GO:0043933, GO:0044249, GO:0034645, GO:0043241, GO:0044699, GO:0044267, GO:0032984, GO:0044260, GO:0016043, GO:0008150, GO:0071704, GO:0010467, GO:0071840, GO:1901576, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0043624, GO:0044238, GO:0071822, GO:0019538, GO:0044237, GO:0043170, GO:0022411, GO:0006412
GO:0006414 [BP]	translational elongation	probable	GO:0071704, GO:0044267, GO:0044238, GO:0008152, GO:0044260, GO:1901576, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:0006412
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0006413 [BP]	translational initiation	probable	GO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699
GO:0031017 [BP]	exocrine pancreas development	probable	GO:0032502, GO:0055123, GO:0048856, GO:0044707, GO:0048513, GO:0032501, GO:0031016, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0032040 [CC]	small-subunit processome	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0006614 [BP]	SRP-dependent cotranslational protein targeting to membrane	probable	GO:0008104, GO:0006613, GO:0006612, GO:0044699, GO:0070972, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0045047, GO:0033365, GO:0044763, GO:0009987
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0000184 [BP]	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain b
Confidence level:very confident
Coverage over the Query: 44-205,242-244,312-438,501-553
View the alignment between query and template
View the model in PyMOL

Template: 2ZKR, chain b
Confidence level:very confident
Coverage over the Query: 15-53,71-94,108-206,241-311
View the alignment between query and template
View the model in PyMOL

Template: 1VQ8, chain B
Confidence level:very confident
Coverage over the Query: 338-489,503-518,529-553
View the alignment between query and template
View the model in PyMOL

Template: 3JYW, chain C
Confidence level:probable
Coverage over the Query: 42-203,240-303
View the alignment between query and template
View the model in PyMOL