Diaphorina citri psyllid: psy16481


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MTCRANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINHL
ccccccEEEEEEcccccccccccccHHHHHHHHHHcccccEEEEECcccHHHHHHHHccccccEECcEEEccccCEEECccCECcccHHHHHHcHHHHHHHHHHHHHHHcccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHcccccccEEEcccccccccccccc
****ANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINH*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCRANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINHL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphomannomutase 2 Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.confidentO15305
Phosphomannomutase 2 Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.confidentQ9Z2M7
Phosphomannomutase 2 Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.confidentQ3SZJ9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0006487 [BP]protein N-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0006013 [BP]mannose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.4.-.-Intramolecular transferases (mutases).probable
5.4.2.-Phosphotransferases (phosphomutases).probable
5.4.2.8Transferred entry: 5.4.2.8.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AMY, chain A
Confidence level:very confident
Coverage over the Query: 4-174
View the alignment between query and template
View the model in PyMOL