Psyllid ID: psy16481


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MTCRANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINHL
ccccccEEEEEEcccccccccccccHHHHHHHHHHcccccEEEEEEcccHHHHHHHHccccccEEEcEEEccccEEEEEccEEEcccHHHHHHcHHHHHHHHHHHHHHHcccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHcccccccEEEcccccccccccccc
ccccccEEEEEEccccccccHccccHHHHHHHHHHHHccEEEEEEccccHHHHHHHHccccHHHHccEEEcccccEEEcccccccHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHccccccEEEEccEEEccccccccc
mtcranticlfdvdgtltqprqKAQNETLDFLLKklkplshlaivsgSDMNKVAEqlggekvleqfdfvfpenglvaykngklfekKSIIDHMGEDKIQTFINYCLQHLstvtlpfkrgnfiEFRTGLINSIIDHMGEDKIQTFINYCLQHLstvtlpfkrgnfiEFRTGLINHL
mtcranticlfdvdgtltqprqKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLStvtlpfkrgnFIEFRTGLINHL
MTCRANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINHL
****ANTICLFDVDGTLTQ******NETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLI***
****ANT*CLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINH*
MTCRANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINHL
****ANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLIN*L
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCRANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q9Z2M7242 Phosphomannomutase 2 OS=M yes N/A 0.697 0.504 0.564 1e-34
Q60HD6246 Phosphomannomutase 2 OS=M N/A N/A 0.731 0.520 0.561 2e-34
O15305246 Phosphomannomutase 2 OS=H yes N/A 0.731 0.520 0.546 4e-34
Q3SZJ9246 Phosphomannomutase 2 OS=B yes N/A 0.731 0.520 0.523 6e-33
O35621262 Phosphomannomutase 1 OS=M no N/A 0.92 0.614 0.412 1e-31
Q92871262 Phosphomannomutase 1 OS=H no N/A 0.92 0.614 0.417 1e-31
Q9VTZ6254 Probable phosphomannomuta yes N/A 0.845 0.582 0.446 1e-31
Q86B09249 Phosphomannomutase 2 OS=D yes N/A 0.851 0.598 0.437 9e-30
Q1W374249 Phosphomannomutase OS=Tri N/A N/A 0.708 0.497 0.468 1e-28
Q54X03249 Phosphomannomutase 1 OS=D no N/A 0.851 0.598 0.431 1e-28
>sp|Q9Z2M7|PMM2_MOUSE Phosphomannomutase 2 OS=Mus musculus GN=Pmm2 PE=2 SV=1 Back     alignment and function desciption
 Score =  145 bits (367), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 94/124 (75%), Gaps = 2/124 (1%)

Query: 7   TICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQF 66
           T+CLFD+DGTLT PRQK   E +D  L+KL+  + + +V GSD  K+ EQLG + V+E++
Sbjct: 3   TLCLFDMDGTLTAPRQKI-TEEMDGFLQKLRQKTKIGVVGGSDFEKLQEQLGND-VVEKY 60

Query: 67  DFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRT 126
           D+VFPENGLVAYK+GKL  K++I  H+GED IQ  INYCL +++ + LP KRG FIEFR 
Sbjct: 61  DYVFPENGLVAYKDGKLLCKQNIQGHLGEDVIQDLINYCLSYIANIKLPKKRGTFIEFRN 120

Query: 127 GLIN 130
           G++N
Sbjct: 121 GMLN 124




Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 4EC: .EC: 2EC: .EC: 8
>sp|Q60HD6|PMM2_MACFA Phosphomannomutase 2 OS=Macaca fascicularis GN=PMM2 PE=2 SV=1 Back     alignment and function description
>sp|O15305|PMM2_HUMAN Phosphomannomutase 2 OS=Homo sapiens GN=PMM2 PE=1 SV=1 Back     alignment and function description
>sp|Q3SZJ9|PMM2_BOVIN Phosphomannomutase 2 OS=Bos taurus GN=PMM2 PE=2 SV=1 Back     alignment and function description
>sp|O35621|PMM1_MOUSE Phosphomannomutase 1 OS=Mus musculus GN=Pmm1 PE=1 SV=1 Back     alignment and function description
>sp|Q92871|PMM1_HUMAN Phosphomannomutase 1 OS=Homo sapiens GN=PMM1 PE=1 SV=2 Back     alignment and function description
>sp|Q9VTZ6|PMM_DROME Probable phosphomannomutase OS=Drosophila melanogaster GN=CG10688 PE=2 SV=1 Back     alignment and function description
>sp|Q86B09|PMM2_DICDI Phosphomannomutase 2 OS=Dictyostelium discoideum GN=pmmB PE=3 SV=2 Back     alignment and function description
>sp|Q1W374|PMM_WHEAT Phosphomannomutase OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q54X03|PMM1_DICDI Phosphomannomutase 1 OS=Dictyostelium discoideum GN=pmmA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
321459567252 hypothetical protein DAPPUDRAFT_299547 [ 0.725 0.503 0.582 3e-37
328723496264 PREDICTED: phosphomannomutase-like isofo 0.742 0.492 0.538 8e-37
328723494247 PREDICTED: phosphomannomutase-like isofo 0.714 0.506 0.552 2e-35
239789563247 ACYPI005456 [Acyrthosiphon pisum] 0.714 0.506 0.552 2e-35
260808775250 hypothetical protein BRAFLDRAFT_113552 [ 0.708 0.496 0.584 2e-35
189240338248 PREDICTED: similar to phosphomannomutase 0.702 0.495 0.593 3e-35
395515139246 PREDICTED: phosphomannomutase 2 [Sarcoph 0.731 0.520 0.561 2e-33
291390567245 PREDICTED: phosphomannomutase 2 [Oryctol 0.731 0.522 0.561 2e-33
195126393250 GI12260 [Drosophila mojavensis] gi|19391 0.742 0.52 0.538 2e-33
71895479247 phosphomannomutase 2 [Gallus gallus] gi| 0.697 0.493 0.556 3e-33
>gi|321459567|gb|EFX70619.1| hypothetical protein DAPPUDRAFT_299547 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 97/127 (76%)

Query: 4   RANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVL 63
           R   ICLFDVDGTLT PR K    T +FLL K+KP++ + +V GSD+ K+AEQ+GG  V+
Sbjct: 7   REEIICLFDVDGTLTMPRNKIIPTTEEFLLTKVKPVATIGLVGGSDLKKIAEQMGGADVI 66

Query: 64  EQFDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIE 123
           ++F++VF ENGLVAYKNG +  K SI +H+GE+K+Q FINY L ++S +TLP KRG FIE
Sbjct: 67  KKFEYVFAENGLVAYKNGHMIGKMSIQEHVGEEKLQKFINYALGYMSKLTLPVKRGTFIE 126

Query: 124 FRTGLIN 130
           FR GL+N
Sbjct: 127 FRDGLVN 133




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328723496|ref|XP_001945623.2| PREDICTED: phosphomannomutase-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328723494|ref|XP_003247856.1| PREDICTED: phosphomannomutase-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|239789563|dbj|BAH71397.1| ACYPI005456 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|260808775|ref|XP_002599182.1| hypothetical protein BRAFLDRAFT_113552 [Branchiostoma floridae] gi|229284459|gb|EEN55194.1| hypothetical protein BRAFLDRAFT_113552 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|189240338|ref|XP_970612.2| PREDICTED: similar to phosphomannomutase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|395515139|ref|XP_003761764.1| PREDICTED: phosphomannomutase 2 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|291390567|ref|XP_002711791.1| PREDICTED: phosphomannomutase 2 [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|195126393|ref|XP_002007655.1| GI12260 [Drosophila mojavensis] gi|193919264|gb|EDW18131.1| GI12260 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|71895479|ref|NP_001026639.1| phosphomannomutase 2 [Gallus gallus] gi|53133828|emb|CAG32243.1| hypothetical protein RCJMB04_20k18 [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
MGI|MGI:1859214242 Pmm2 "phosphomannomutase 2" [M 0.697 0.504 0.564 3.6e-34
UNIPROTKB|F1N8Z6251 PMM2 "Uncharacterized protein" 0.691 0.482 0.560 5.8e-34
RGD|1309366242 Pmm2 "phosphomannomutase 2" [R 0.697 0.504 0.556 3.2e-33
UNIPROTKB|O15305246 PMM2 "Phosphomannomutase 2" [H 0.731 0.520 0.546 4.1e-33
UNIPROTKB|E1C4B8249 PMM2 "Uncharacterized protein" 0.691 0.485 0.552 8.5e-33
UNIPROTKB|E2R832251 PMM2 "Uncharacterized protein" 0.731 0.509 0.530 1.4e-32
UNIPROTKB|Q3SZJ9246 PMM2 "Phosphomannomutase 2" [B 0.731 0.520 0.523 3.7e-32
UNIPROTKB|Q0VC17262 PMM1 "Phosphomannomutase 1" [B 0.72 0.480 0.507 9.8e-32
UNIPROTKB|F1SRD8262 PMM1 "Uncharacterized protein" 0.72 0.480 0.507 1.6e-31
MGI|MGI:1353418262 Pmm1 "phosphomannomutase 1" [M 0.697 0.465 0.524 2e-31
MGI|MGI:1859214 Pmm2 "phosphomannomutase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 371 (135.7 bits), Expect = 3.6e-34, P = 3.6e-34
 Identities = 70/124 (56%), Positives = 94/124 (75%)

Query:     7 TICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQF 66
             T+CLFD+DGTLT PRQK   E +D  L+KL+  + + +V GSD  K+ EQLG + V+E++
Sbjct:     3 TLCLFDMDGTLTAPRQKITEE-MDGFLQKLRQKTKIGVVGGSDFEKLQEQLGND-VVEKY 60

Query:    67 DFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRT 126
             D+VFPENGLVAYK+GKL  K++I  H+GED IQ  INYCL +++ + LP KRG FIEFR 
Sbjct:    61 DYVFPENGLVAYKDGKLLCKQNIQGHLGEDVIQDLINYCLSYIANIKLPKKRGTFIEFRN 120

Query:   127 GLIN 130
             G++N
Sbjct:   121 GMLN 124


GO:0003824 "catalytic activity" evidence=IEA
GO:0004615 "phosphomannomutase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0008152 "metabolic process" evidence=IEA
GO:0016853 "isomerase activity" evidence=IEA
GO:0019307 "mannose biosynthetic process" evidence=IEA
GO:0043025 "neuronal cell body" evidence=IDA
UNIPROTKB|F1N8Z6 PMM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1309366 Pmm2 "phosphomannomutase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O15305 PMM2 "Phosphomannomutase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4B8 PMM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R832 PMM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZJ9 PMM2 "Phosphomannomutase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VC17 PMM1 "Phosphomannomutase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRD8 PMM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1353418 Pmm1 "phosphomannomutase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3SZJ9PMM2_BOVIN5, ., 4, ., 2, ., 80.52300.73140.5203yesN/A
Q9Z2M7PMM2_MOUSE5, ., 4, ., 2, ., 80.56450.69710.5041yesN/A
O15305PMM2_HUMAN5, ., 4, ., 2, ., 80.54610.73140.5203yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer5.4.2.80.824
3rd Layer5.4.20.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
PTZ00174247 PTZ00174, PTZ00174, phosphomannomutase; Provisiona 9e-54
PLN02423245 PLN02423, PLN02423, phosphomannomutase 5e-43
pfam03332219 pfam03332, PMM, Eukaryotic phosphomannomutase 2e-37
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 3e-05
COG0561264 COG0561, Cof, Predicted hydrolases of the HAD supe 9e-05
pfam08282254 pfam08282, Hydrolase_3, haloacid dehalogenase-like 7e-04
>gnl|CDD|240305 PTZ00174, PTZ00174, phosphomannomutase; Provisional Back     alignment and domain information
 Score =  170 bits (433), Expect = 9e-54
 Identities = 66/125 (52%), Positives = 88/125 (70%), Gaps = 1/125 (0%)

Query: 6   NTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQ 65
            TI LFDVDGTLT+PR     E  D L K       + +V GSD  K+ EQLG E VLE 
Sbjct: 5   KTILLFDVDGTLTKPRNPITQEMKDTLAKLKSKGFKIGVVGGSDYPKIKEQLG-EDVLED 63

Query: 66  FDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFR 125
           FD+VF ENGLVAYK+G+LF  +SI+  +GE+K++ FIN+CL++++ + +P KRG FIE+R
Sbjct: 64  FDYVFSENGLVAYKDGELFHSQSILKFLGEEKLKKFINFCLRYIADLDIPVKRGTFIEYR 123

Query: 126 TGLIN 130
            G+IN
Sbjct: 124 NGMIN 128


Length = 247

>gnl|CDD|178043 PLN02423, PLN02423, phosphomannomutase Back     alignment and domain information
>gnl|CDD|202597 pfam03332, PMM, Eukaryotic phosphomannomutase Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|223635 COG0561, Cof, Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|219777 pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
PTZ00174247 phosphomannomutase; Provisional 99.95
PRK10513270 sugar phosphate phosphatase; Provisional 99.95
PLN02423245 phosphomannomutase 99.94
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 99.94
PRK10976266 putative hydrolase; Provisional 99.94
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.93
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 99.92
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 99.92
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 99.92
PLN02887580 hydrolase family protein 99.91
KOG3189|consensus252 99.91
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.89
PRK01158230 phosphoglycolate phosphatase; Provisional 99.86
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 99.83
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 99.83
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 99.82
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 99.82
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 99.8
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 99.79
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 99.78
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 99.77
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 99.76
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.76
PF03332220 PMM: Eukaryotic phosphomannomutase; InterPro: IPR0 99.73
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 99.71
PLN02382 413 probable sucrose-phosphatase 99.7
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.69
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 99.67
PLN03017366 trehalose-phosphatase 99.62
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 99.62
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 99.58
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 99.56
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 99.49
PLN02151354 trehalose-phosphatase 99.49
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 99.41
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 99.41
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 99.4
PLN02580384 trehalose-phosphatase 99.4
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 99.39
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 99.32
TIGR01684301 viral_ppase viral phosphatase. These proteins also 99.27
PHA03398303 viral phosphatase superfamily protein; Provisional 99.12
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.0
COG3769 274 Predicted hydrolase (HAD superfamily) [General fun 98.83
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.78
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.74
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 98.7
PLN02645 311 phosphoglycolate phosphatase 98.63
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 98.59
PRK10444248 UMP phosphatase; Provisional 98.58
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 98.56
KOG1050|consensus732 98.55
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 98.52
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 98.31
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 98.29
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 98.28
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 98.07
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 98.05
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.98
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 97.91
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 97.89
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 97.85
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.85
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 97.82
PRK13222226 phosphoglycolate phosphatase; Provisional 97.77
PRK13288214 pyrophosphatase PpaX; Provisional 97.76
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 97.74
PHA02530300 pseT polynucleotide kinase; Provisional 97.7
PRK13225273 phosphoglycolate phosphatase; Provisional 97.69
COG0647269 NagD Predicted sugar phosphatases of the HAD super 97.63
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 97.63
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 97.61
PRK14988224 GMP/IMP nucleotidase; Provisional 97.57
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 97.57
PRK06769173 hypothetical protein; Validated 97.53
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 97.5
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 97.45
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 97.44
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 97.43
PLN02940 382 riboflavin kinase 97.42
PLN02954224 phosphoserine phosphatase 97.4
PRK13582205 thrH phosphoserine phosphatase; Provisional 97.39
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 97.38
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 97.37
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 97.35
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 97.33
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 97.33
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.32
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 97.32
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 97.29
PLN02575381 haloacid dehalogenase-like hydrolase 97.24
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 97.23
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 97.2
PTZ00445219 p36-lilke protein; Provisional 97.16
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 97.13
PRK08238 479 hypothetical protein; Validated 97.11
PRK11587218 putative phosphatase; Provisional 97.1
TIGR01675229 plant-AP plant acid phosphatase. This model explic 97.1
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 97.09
PRK10748238 flavin mononucleotide phosphatase; Provisional 97.07
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 97.07
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 97.07
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 97.02
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 96.9
PLN02770248 haloacid dehalogenase-like hydrolase family protei 96.89
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 96.88
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 96.81
COG0546220 Gph Predicted phosphatases [General function predi 96.79
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 96.77
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 96.74
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 96.72
COG0241181 HisB Histidinol phosphatase and related phosphatas 96.71
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 96.69
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 96.67
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 96.65
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 96.62
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 96.61
PRK10563221 6-phosphogluconate phosphatase; Provisional 96.6
PLN02779286 haloacid dehalogenase-like hydrolase family protei 96.59
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 96.58
PRK13223272 phosphoglycolate phosphatase; Provisional 96.54
PRK11590211 hypothetical protein; Provisional 96.53
PRK13226229 phosphoglycolate phosphatase; Provisional 96.38
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 96.35
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 96.32
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 96.28
COG0637221 Predicted phosphatase/phosphohexomutase [General f 96.25
COG4996164 Predicted phosphatase [General function prediction 96.24
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 96.1
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 96.05
PHA02597197 30.2 hypothetical protein; Provisional 96.04
PRK09449224 dUMP phosphatase; Provisional 95.97
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 95.87
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 95.84
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 95.83
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 95.74
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 95.71
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 95.64
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 95.63
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 95.5
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 95.36
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 95.34
PRK11133322 serB phosphoserine phosphatase; Provisional 95.16
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 95.16
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 94.94
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 94.93
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 94.48
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 94.39
KOG1615|consensus227 94.24
COG4087152 Soluble P-type ATPase [General function prediction 94.07
COG4359220 Uncharacterized conserved protein [Function unknow 93.84
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 93.78
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 93.58
PF06437408 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 93.25
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 93.1
COG5083580 SMP2 Uncharacterized protein involved in plasmid m 93.08
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 92.5
KOG3109|consensus244 92.01
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 91.88
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 91.72
PLN02177 497 glycerol-3-phosphate acyltransferase 91.64
KOG2116|consensus738 91.32
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 91.09
PLN02499 498 glycerol-3-phosphate acyltransferase 90.97
KOG1618|consensus 389 89.66
KOG2134|consensus 422 89.36
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 89.13
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 88.36
KOG3120|consensus256 87.91
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 87.35
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 87.33
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 86.43
PLN02770248 haloacid dehalogenase-like hydrolase family protei 86.37
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 86.26
KOG3040|consensus262 85.44
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 85.21
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 85.13
KOG2914|consensus222 84.61
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 84.37
COG0546220 Gph Predicted phosphatases [General function predi 84.2
PRK11590211 hypothetical protein; Provisional 84.08
PF0904735 MEF2_binding: MEF2 binding; InterPro: IPR015134 Th 83.54
PF04312138 DUF460: Protein of unknown function (DUF460); Inte 83.53
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 83.46
COG3700237 AphA Acid phosphatase (class B) [General function 81.82
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 81.81
KOG3085|consensus237 81.38
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 81.24
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 81.01
PRK13223272 phosphoglycolate phosphatase; Provisional 80.42
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 80.35
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
Probab=99.95  E-value=2.3e-27  Score=185.90  Aligned_cols=171  Identities=43%  Similarity=0.710  Sum_probs=122.8

Q ss_pred             CCCCcceEEEEecCCCccCCCCCCCHHHHHHHHHhhCCC-eEEEEEcCCCHHHHHHHhcCCCcccccceEEecCCceeee
Q psy16481          1 MTCRANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPL-SHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYK   79 (175)
Q Consensus         1 ~~~~~~kli~~DlDGTLl~~~~~i~~~~~~~~l~~l~~~-i~~~iaTGR~~~~~~~~~~~~~~~~~~~~~i~~NGa~i~~   79 (175)
                      |.|+ +|+||+|||||||+++++++++++++ |++++++ ++|++||||++..+.+.++.... ...+++||+|||+|+.
T Consensus         1 ~~~~-~klia~DlDGTLL~~~~~is~~~~~a-i~~l~~~Gi~~viaTGR~~~~i~~~l~~~~~-~~~~~~I~~NGa~I~~   77 (247)
T PTZ00174          1 MEMK-KTILLFDVDGTLTKPRNPITQEMKDT-LAKLKSKGFKIGVVGGSDYPKIKEQLGEDVL-EDFDYVFSENGLVAYK   77 (247)
T ss_pred             CCCC-CeEEEEECcCCCcCCCCCCCHHHHHH-HHHHHHCCCEEEEEcCCCHHHHHHHHhhhhh-cccCeEEeCCceEEEE
Confidence            4455 79999999999999999999999999 9999999 99999999999999888864211 1124789999999998


Q ss_pred             CCeEeeccchhhhhCHHHHHHHHHHHHHhcccccccccccceeeecccccccch--------------hhcc-HHHHHHH
Q psy16481         80 NGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSII--------------DHMG-EDKIQTF  144 (175)
Q Consensus        80 ~~~~i~~~~l~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~--------------~~~~-~~~~~~~  144 (175)
                      +++.+++..+...++.+.+.++++.+.++...+.++...+.|+..........+              .+.. .+...++
T Consensus        78 ~~~~i~~~~i~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (247)
T PTZ00174         78 DGELFHSQSILKFLGEEKLKKFINFCLRYIADLDIPVKRGTFIEYRNGMINISPIGRNCSQEERDEFEKYDKEHHIREKF  157 (247)
T ss_pred             CCeEEEEEcchhcCCHHHHHHHHHHHHHHHHhcCCccceeeeEEcCCceEEeccccccCCHHHHHHHHhcCCcchHHHHH
Confidence            888888877533347899999999887653333333444555443211100000              0111 2234567


Q ss_pred             HHHHHHhcCCCCCceee--cceE-EecCCcccC
Q psy16481        145 INYCLQHLSTVTLPFKR--GNFI-EFRTGLINH  174 (175)
Q Consensus       145 ~~~l~~~~~~~~~~~s~--~~~i-i~~~Gv~K~  174 (175)
                      .+.+.+.|+++.+..+.  +.++ ++|+|+||.
T Consensus       158 ~~~l~~~~~~~~~~~s~~~~~~leI~~~gvsKg  190 (247)
T PTZ00174        158 IQDLKKEFSDLGLKFSIGGQISFDVFPKGWDKT  190 (247)
T ss_pred             HHHHHHhcCCCCeEEEecCceEEEeeeCCCcHH
Confidence            77888888766666665  3688 999999995



>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>KOG3189|consensus Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PF03332 PMM: Eukaryotic phosphomannomutase; InterPro: IPR005002 This enzyme (5 Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>KOG1050|consensus Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG1615|consensus Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>KOG3109|consensus Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>KOG2116|consensus Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>KOG1618|consensus Back     alignment and domain information
>KOG2134|consensus Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>KOG3120|consensus Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>KOG3040|consensus Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>KOG2914|consensus Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PF09047 MEF2_binding: MEF2 binding; InterPro: IPR015134 The myocyte enhancer factor-2 (MEF2) binding domain, predominantly found in the calcineurin-binding protein CABIN 1, adopts an amphipathic alpha-helical structure, which allows it to bind a hydrophobic groove on the MEF2S domain, forming a triple-helical interaction Back     alignment and domain information
>PF04312 DUF460: Protein of unknown function (DUF460); InterPro: IPR007408 This is an archaeal protein of unknown function Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>KOG3085|consensus Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
2amy_A246 X-Ray Structure Of Human Phosphomannomutase 2 (Pmm2 3e-34
2fuc_A262 Human Alpha-Phosphomannomutase 1 With Mg2+ Cofactor 9e-32
2i54_A247 Phosphomannomutase From Leishmania Mexicana Length 6e-27
3f9r_A246 Crystal Structure Of Trypanosoma Brucei Phosphomann 9e-23
>pdb|2AMY|A Chain A, X-Ray Structure Of Human Phosphomannomutase 2 (Pmm2) Length = 246 Back     alignment and structure

Iteration: 1

Score = 140 bits (354), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 70/124 (56%), Positives = 90/124 (72%), Gaps = 2/124 (1%) Query: 7 TICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQF 66 +CLFDVDGTLT PRQK E DFL +KL+ + +V GSD KV EQLG + V+E++ Sbjct: 7 ALCLFDVDGTLTAPRQKITKEXDDFL-QKLRQKIKIGVVGGSDFEKVQEQLGND-VVEKY 64 Query: 67 DFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRT 126 D+VFPENGLVAYK+GKL +++I H+GE IQ INYCL +++ + LP KRG FIEFR Sbjct: 65 DYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRN 124 Query: 127 GLIN 130 G +N Sbjct: 125 GXLN 128
>pdb|2FUC|A Chain A, Human Alpha-Phosphomannomutase 1 With Mg2+ Cofactor Bound Length = 262 Back     alignment and structure
>pdb|2I54|A Chain A, Phosphomannomutase From Leishmania Mexicana Length = 247 Back     alignment and structure
>pdb|3F9R|A Chain A, Crystal Structure Of Trypanosoma Brucei Phosphomannosemutase, Tb.10.700.370 Length = 246 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 3e-26
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 3e-25
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 6e-25
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} PDB: 2i54_A* 2i55_A* Length = 246 Back     alignment and structure
 Score = 99.2 bits (246), Expect = 3e-26
 Identities = 53/146 (36%), Positives = 83/146 (56%), Gaps = 3/146 (2%)

Query: 6   NTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQ 65
             + LFDVDGTLT PR    +E    + +       +  V GSD  K  EQL G  VL Q
Sbjct: 4   RVLLLFDVDGTLTPPRLCQTDEMRALIKRARGAGFCVGTVGGSDFAKQVEQL-GRDVLTQ 62

Query: 66  FDFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFR 125
           FD+VF ENGL+AY+NG    ++S+++ +G D+I  F+   L+ ++ + +P +RG F+E+R
Sbjct: 63  FDYVFAENGLLAYRNGLEIHRQSLLNALGNDRIVKFVKKTLRLIADLDIPVQRGTFVEYR 122

Query: 126 TGLINSIIDHMGEDKIQTFINYCLQH 151
            G+IN  +  +G +  Q   +    +
Sbjct: 123 NGMIN--VSPIGRNCSQAERDEFEVY 146


>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Length = 246 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Length = 262 Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 99.96
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 99.94
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 99.94
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 99.93
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.93
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.92
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.92
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 99.92
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 99.91
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.91
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 99.91
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.91
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 99.91
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.9
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 99.9
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.89
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.88
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.87
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 99.86
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 99.85
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.81
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.8
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 99.78
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 99.75
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 99.68
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.56
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 99.5
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.48
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.46
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 99.44
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.41
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.25
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.13
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.11
1y8a_A 332 Hypothetical protein AF1437; structural genomics, 99.09
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.06
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 98.98
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 98.93
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 98.92
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.89
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 98.86
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 98.83
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.81
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 98.76
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 98.61
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.61
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 98.59
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 98.57
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 98.56
3ib6_A189 Uncharacterized protein; structural genomics, unkn 98.51
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.5
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.5
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.49
3fvv_A232 Uncharacterized protein; unknown function, structu 98.43
3mn1_A189 Probable YRBI family phosphatase; structural genom 98.43
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.37
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 98.35
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.33
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.32
3mmz_A176 Putative HAD family hydrolase; structural genomics 98.32
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 98.29
2o2x_A218 Hypothetical protein; structural genomics, joint c 98.28
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.27
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 98.23
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.21
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.19
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 98.16
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 98.16
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.16
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.16
1te2_A226 Putative phosphatase; structural genomics, phospha 98.14
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.14
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 98.1
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 98.08
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 98.08
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.06
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.03
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.03
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 98.0
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.0
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 97.99
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 97.99
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 97.97
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 97.94
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 97.94
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 97.92
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 97.92
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 97.89
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 97.89
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 97.88
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 97.85
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.83
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 97.81
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 97.81
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 97.81
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 97.8
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 97.79
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 97.79
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 97.77
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 97.76
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 97.76
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 97.74
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.74
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 97.71
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 97.71
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 97.7
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 97.68
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 97.67
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 97.66
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 97.66
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 97.65
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 97.63
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 97.63
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 97.57
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 97.56
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 97.54
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 97.54
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 97.52
3sd7_A240 Putative phosphatase; structural genomics, haloaci 97.48
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 97.43
2p11_A231 Hypothetical protein; putative haloacid dehalogena 97.42
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 97.4
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 97.38
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 97.33
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 97.33
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 97.25
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 97.23
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 97.21
2hsz_A243 Novel predicted phosphatase; structural genomics, 97.13
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 97.1
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 97.08
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 97.0
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 96.96
2zg6_A220 Putative uncharacterized protein ST2620, probable 96.91
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 96.78
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 96.66
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 96.65
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.61
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 96.34
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 96.21
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 95.98
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 95.93
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 95.79
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 95.72
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 95.42
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 95.34
3n28_A 335 Phosphoserine phosphatase; HAD family hydrolase, s 94.84
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 94.61
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 94.33
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 93.72
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 93.7
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 93.41
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 93.38
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 91.25
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 90.65
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 87.99
1n6j_G35 Calcineurin-binding protein cabin 1; MADS-BOX, pro 85.78
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 83.73
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
Probab=99.96  E-value=2.5e-28  Score=189.95  Aligned_cols=168  Identities=33%  Similarity=0.569  Sum_probs=130.1

Q ss_pred             cceEEEEecCCCccCCCCCCCHHHHHHHHHhhCCC-eEEEEEcCCCHHHHHHHhcCCCcccccceEEecCCceeeeCCeE
Q psy16481          5 ANTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPL-SHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYKNGKL   83 (175)
Q Consensus         5 ~~kli~~DlDGTLl~~~~~i~~~~~~~~l~~l~~~-i~~~iaTGR~~~~~~~~~~~~~~~~~~~~~i~~NGa~i~~~~~~   83 (175)
                      .+|+|||||||||++++++++++++++ |++|+++ +.|++||||++..+.+.++.. +....+++||+||+.|+..|++
T Consensus         3 ~~kli~~DlDGTLl~~~~~i~~~~~~~-l~~l~~~g~~~~iaTGR~~~~~~~~l~~~-~~~~~~~~i~~NGa~i~~~~~~   80 (246)
T 3f9r_A            3 KRVLLLFDVDGTLTPPRLCQTDEMRAL-IKRARGAGFCVGTVGGSDFAKQVEQLGRD-VLTQFDYVFAENGLLAYRNGLE   80 (246)
T ss_dssp             CSEEEEECSBTTTBSTTSCCCHHHHHH-HHHHHHTTCEEEEECSSCHHHHHHHHCTT-HHHHCSEEEEGGGTEEEETTEE
T ss_pred             CceEEEEeCcCCcCCCCCccCHHHHHH-HHHHHHCCCEEEEECCCCHHHHHHHhhhh-ccccCCEEEECCCcEEEECCEE
Confidence            489999999999999999999999999 9999999 999999999999988887641 1112358999999999998999


Q ss_pred             eeccchhhhhCHHHHHHHHHHHHHhcccccccccccceeeecccccccch--------------hhccHHH-HHHHHHHH
Q psy16481         84 FEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGLINSII--------------DHMGEDK-IQTFINYC  148 (175)
Q Consensus        84 i~~~~l~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~--------------~~~~~~~-~~~~~~~l  148 (175)
                      +++..+...++.+.+++++++++++...+.++..++.|++.+.....+.+              .+.+... ..++.+.+
T Consensus        81 i~~~~i~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  160 (246)
T 3f9r_A           81 IHRQSLLNALGNDRIVKFVKKTLRLIADLDIPVQRGTFVEYRNGMINVSPIGRNCSQAERDEFEVYDNEHRVRASLIAEL  160 (246)
T ss_dssp             EEECCHHHHTCHHHHHHHHHHHHHHHHTCCCSCCCSCCEEECSSCEEECSSCTTSCHHHHHHHHHHHHHHCHHHHHHHHH
T ss_pred             EEEeeccccCCHHHHHHHHHHHHhhhhceeeecCCceEEEeecceeccccccccCchhhceeeeEecccchHHHHHHHHH
Confidence            99888644457999999999988775555555556677665432211110              1212222 35778888


Q ss_pred             HHhcCC--CCCceeecceE-EecCCcccC
Q psy16481        149 LQHLST--VTLPFKRGNFI-EFRTGLINH  174 (175)
Q Consensus       149 ~~~~~~--~~~~~s~~~~i-i~~~Gv~K~  174 (175)
                      .+.|++  ++++.|++.++ ++|+|+||.
T Consensus       161 ~~~~~~~~~~~~~sg~~~leI~~~gv~Kg  189 (246)
T 3f9r_A          161 ENSFPDFGLKYSIGGQISFDVFPVGWDKT  189 (246)
T ss_dssp             HHHCGGGCEEEEEETTTEEEEEETTCSGG
T ss_pred             HhhCcCCcEEEEecCCeEEEEEeCCCCHH
Confidence            888986  56789999999 999999996



>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d2amya1243 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human ( 2e-11
d2fuea1244 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human 5e-09
d1u02a_229 c.108.1.15 (A:) Trehalose-6-phosphate phosphatase 3e-06
d1nf2a_ 267 c.108.1.10 (A:) Hypothetical protein TM0651 {Therm 4e-04
d1l6ra_225 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 9e-04
d1s2oa1244 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 { 0.002
d1rkqa_271 c.108.1.10 (A:) Hypothetical protein YidA {Escheri 0.003
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Predicted hydrolases Cof
domain: Phosphomannomutase 2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 58.5 bits (140), Expect = 2e-11
 Identities = 70/133 (52%), Positives = 90/133 (67%), Gaps = 2/133 (1%)

Query: 7   TICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQF 66
            +CLFDVDGTLT PRQK   E  DF L+KL+    + +V GSD  KV EQL G  V+E++
Sbjct: 4   ALCLFDVDGTLTAPRQKITKEMDDF-LQKLRQKIKIGVVGGSDFEKVQEQL-GNDVVEKY 61

Query: 67  DFVFPENGLVAYKNGKLFEKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRT 126
           D+VFPENGLVAYK+GKL  +++I  H+GE  IQ  INYCL +++ + LP KRG FIEFR 
Sbjct: 62  DYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRN 121

Query: 127 GLINSIIDHMGED 139
           G++N         
Sbjct: 122 GMLNVSPIGRSCS 134


>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 229 Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267 Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 244 Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 99.93
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.91
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.91
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 99.9
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.89
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 99.86
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 99.83
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 99.82
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 99.81
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.77
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 99.7
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.69
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 99.68
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 99.67
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 98.73
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 98.72
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.68
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 98.55
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 98.4
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 98.4
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.29
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 98.24
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 98.23
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 98.16
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 98.1
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 98.07
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 98.0
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 97.96
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 97.84
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 97.81
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 97.75
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 97.71
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 97.59
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 97.52
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 97.52
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 97.42
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 97.41
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 97.36
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 97.29
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 97.24
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 97.11
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 96.61
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 96.45
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 96.43
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 96.39
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 96.0
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 95.99
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 95.66
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 95.66
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 95.57
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 95.42
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 95.35
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 95.26
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 94.91
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 93.86
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 92.54
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 85.76
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Predicted hydrolases Cof
domain: Hypothetical protein TM0651
species: Thermotoga maritima [TaxId: 2336]
Probab=99.93  E-value=5.5e-26  Score=175.61  Aligned_cols=162  Identities=11%  Similarity=0.043  Sum_probs=126.3

Q ss_pred             ceEEEEecCCCccCCCCCCCHHHHHHHHHhhCCCeEEEEEcCCCHHHHHHHhcCCCcccccceEEecCCceeee-CCeEe
Q psy16481          6 NTICLFDVDGTLTQPRQKAQNETLDFLLKKLKPLSHLAIVSGSDMNKVAEQLGGEKVLEQFDFVFPENGLVAYK-NGKLF   84 (175)
Q Consensus         6 ~kli~~DlDGTLl~~~~~i~~~~~~~~l~~l~~~i~~~iaTGR~~~~~~~~~~~~~~~~~~~~~i~~NGa~i~~-~~~~i   84 (175)
                      +|+|+|||||||++++++++++++++ |+++++.+++++||||++..+.+.+...+.  ...++|++|||.|+. +++.+
T Consensus         2 ~Kli~~DlDGTL~~~~~~i~~~~~~a-l~~l~~~~~~~i~TGR~~~~~~~~~~~~~~--~~~~~I~~nGa~i~~~~~~~i   78 (267)
T d1nf2a_           2 YRVFVFDLDGTLLNDNLEISEKDRRN-IEKLSRKCYVVFASGRMLVSTLNVEKKYFK--RTFPTIAYNGAIVYLPEEGVI   78 (267)
T ss_dssp             BCEEEEECCCCCSCTTSCCCHHHHHH-HHHHTTTSEEEEECSSCHHHHHHHHHHHSS--SCCCEEEGGGTEEEETTTEEE
T ss_pred             eEEEEEeCCccccCCcCccCHHHHHH-HHHHHcCCEEEEECCCChHHHHHHHHHhcc--cCCceeccCCeEEEecccccc
Confidence            68999999999999999999999999 999987777999999999998777765421  123689999999996 67888


Q ss_pred             eccchhhhhCHHHHHHHHHHHHHhcccccccccccceeeecccc----------c-ccch---------------hhccH
Q psy16481         85 EKKSIIDHMGEDKIQTFINYCLQHLSTVTLPFKRGNFIEFRTGL----------I-NSII---------------DHMGE  138 (175)
Q Consensus        85 ~~~~l~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~~~~~~----------~-~~~~---------------~~~~~  138 (175)
                      +.+.+    +.+.+.++++++.++...+.++..++.|.......          . ...+               .....
T Consensus        79 ~~~~i----~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~  154 (267)
T d1nf2a_          79 LNEKI----PPEVAKDIIEYIKPLNVHWQAYIDDVLYSEKDNEEIKSYARHSNVDYRVEPNLSELVSKMGTTKLLLIDTP  154 (267)
T ss_dssp             EECCB----CHHHHHHHHHHHGGGCCCEEEECSSCEEESSCCHHHHHHHHHTTCCEEECTTHHHHHHHHCBSEEEEECCH
T ss_pred             cccCC----CHHHHHHHHHHHHhcCceEEEeeCceEEecCCcHHHHHHHHhcCCCceecCcHHHHhhhccceEEEEeccH
Confidence            88888    99999999999999887665555555554322100          0 0000               11235


Q ss_pred             HHHHHHHHHHHHhcCC-CCCceeecceE-EecCCcccC
Q psy16481        139 DKIQTFINYCLQHLST-VTLPFKRGNFI-EFRTGLINH  174 (175)
Q Consensus       139 ~~~~~~~~~l~~~~~~-~~~~~s~~~~i-i~~~Gv~K~  174 (175)
                      +..+++.+.+.+.+++ +.+..+++.++ ++|+|+||.
T Consensus       155 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~di~~~~~~K~  192 (267)
T d1nf2a_         155 ERLDELKEILSERFKDVVKVFKSFPTYLEIVPKNVDKG  192 (267)
T ss_dssp             HHHHHHHHHHHHHHTTTSEEEEEETTEEEEECTTCCHH
T ss_pred             HHHHHHHHHHHHhhCCcEEEEEeecceeeecCCCCchh
Confidence            5667888888888885 88888999999 999999995



>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure