Diaphorina citri psyllid: psy16496

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----

MELNITNLTFLFFCFQRLKEKLNTLAISVMNEWPGVRLRVIEGWDEEGHHASDSLHYEGRAVDITTSDRDSSKYGLLARMAVEAGFDWVYYESRNHIHCSVKTETTHVNGKGAGCFTGDSTVTLDNHKTINITDLNIGDKVLTLNTITGEMEYSEVLLFLHRDPNLVHNFVQITTESGSLIKMTPSHLILRWHRPNAKSILNDIEYTYAERVRVNDSIIVHKNGKARNGIQRGAPIPPPRPKPCP

cEEEEEccEEEEEEHHHHHHHHHHHHHHHHHHccccEEEEEEECcccccccccccccccCEEEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcccccEEEcccccccEEEEECcccccEEEEEEEEEEECccccCEEEEEEEEccccEEEEcccccEEEEcccccccccccccEEEccccccccEEEEECccCCccccccccccccccccccc

**LNITNLTFLFFCFQRLKEKLNTLAISVMNEWPGVRLRVIEGWDEEGHHASDSLHYEGRAVDITTSDRDSSKYGLLARMAVEAGFDWVYYESRNHIHCSVKTETTHVNGKGAGCFTGDSTVTLDNHKTINITDLNIGDKVLTLNTITGEMEYSEVLLFLHRDPNLVHNFVQITTESGSLIKMTPSHLILRWHRPNAKSILNDIEYTYAERVRVNDSIIVHKNG*********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Sonic hedgehog protein	Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. Also regulates another target, the gli oncogene. Intercellular signal essential for a variety of patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior-posterior axis of the developing limb bud. Displays both floor plate- and motor neuron-inducing activity. The threshold concentration of N-product required for motor neuron induction is 5-fold lower than that required for floor plate induction.	confident	Q15465
Indian hedgehog protein	Intercellular signal essential for a variety of patterning events during development. Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. Implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones. Induces the expression of parathyroid hormone-related protein (PTHRP).	confident	P97812

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007440 [BP]	foregut morphogenesis	probable	GO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0048546, GO:0044699
GO:0051781 [BP]	positive regulation of cell division	probable	GO:0050794, GO:0051302, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0002053 [BP]	positive regulation of mesenchymal cell proliferation	probable	GO:0008284, GO:0042127, GO:0050794, GO:0050789, GO:0010464, GO:0065007, GO:2000648, GO:0048518, GO:0008150, GO:0072091, GO:0048522
GO:0021940 [BP]	positive regulation of cerebellar granule cell precursor proliferation	probable	GO:0008284, GO:0042127, GO:0050793, GO:2000177, GO:2000179, GO:0050789, GO:0051960, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0065007, GO:0050794, GO:0021936, GO:0048522
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0055002 [BP]	striated muscle cell development	probable	GO:0032502, GO:0055001, GO:0048856, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0044763, GO:0051146, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699
GO:0007405 [BP]	neuroblast proliferation	probable	GO:0032502, GO:0048699, GO:0048856, GO:0044707, GO:0007399, GO:0008283, GO:0009987, GO:0048869, GO:0030154, GO:0044763, GO:0007275, GO:0032501, GO:0008150, GO:0061351, GO:0048731, GO:0022008, GO:0072089, GO:0044699
GO:0097190 [BP]	apoptotic signaling pathway	probable	GO:0010259, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0006915, GO:0050794, GO:0008150, GO:0012501, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007569, GO:0050789, GO:0044699
GO:0060020 [BP]	Bergmann glial cell differentiation	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0048708, GO:0042063, GO:0008150, GO:0032501, GO:0044763, GO:0010001, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0007417
GO:0045880 [BP]	positive regulation of smoothened signaling pathway	probable	GO:0008589, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0045445 [BP]	myoblast differentiation	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699
GO:0032355 [BP]	response to estradiol stimulus	probable	GO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0014070, GO:0009725, GO:0043627, GO:0042221, GO:0097305, GO:0010033, GO:0048545
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0032526 [BP]	response to retinoic acid	probable	GO:1901700, GO:0033993, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0021915 [BP]	neural tube development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0048596 [BP]	embryonic camera-type eye morphogenesis	probable	GO:0032502, GO:0048562, GO:0048568, GO:0031076, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0048513, GO:0048048, GO:0048598, GO:0009887, GO:0032501, GO:0048592, GO:0048593, GO:0044767, GO:0008150, GO:0048731, GO:0007423, GO:0044707, GO:0048856, GO:0001654, GO:0043010
GO:0033089 [BP]	positive regulation of T cell differentiation in thymus	probable	GO:0050865, GO:0033081, GO:0050867, GO:0050863, GO:0045580, GO:0045582, GO:0050789, GO:0051249, GO:0002684, GO:0002682, GO:0045621, GO:0065007, GO:0050793, GO:0050870, GO:0050794, GO:0045597, GO:0048518, GO:0045595, GO:0008150, GO:0051239, GO:0051094, GO:0051251, GO:1902107, GO:0002694, GO:1902105, GO:0002696, GO:2000026, GO:0045619, GO:0048522
GO:0070447 [BP]	positive regulation of oligodendrocyte progenitor proliferation	probable	GO:0042127, GO:0030154, GO:0050789, GO:0044699, GO:0014015, GO:0014013, GO:0048869, GO:0060284, GO:0050769, GO:2000177, GO:0065007, GO:0010720, GO:0048518, GO:2000179, GO:0008284, GO:0032501, GO:0050767, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0032502, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0070445, GO:0048522
GO:0060662 [BP]	salivary gland cavitation	probable	GO:0032502, GO:0048513, GO:0007435, GO:0035239, GO:0044707, GO:0060605, GO:0007431, GO:0032501, GO:0048856, GO:0035148, GO:0044767, GO:0035272, GO:0008150, GO:0044699, GO:0048731, GO:0007275, GO:0022612, GO:0048732, GO:0009653, GO:0035295, GO:0048646
GO:0048074 [BP]	negative regulation of eye pigmentation	probable	GO:0051093, GO:0048086, GO:0050793, GO:0048073, GO:0048070, GO:0008150, GO:0065007, GO:0048519, GO:0050789
GO:0043237 [MF]	laminin-1 binding	probable	GO:0043236, GO:0003674, GO:0005488, GO:0005515, GO:0050840
GO:0046534 [BP]	positive regulation of photoreceptor cell differentiation	probable	GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0051240, GO:0060284, GO:0007275, GO:0045664, GO:0045666, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0046532, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0001569 [BP]	patterning of blood vessels	probable	GO:0048754, GO:0072359, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001525, GO:0001568, GO:0001944, GO:0048514, GO:0048729, GO:0060562, GO:0048646, GO:0032502, GO:0032501, GO:0035239, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0044707, GO:0048856, GO:0072358, GO:0048731, GO:0002009
GO:0048557 [BP]	embryonic digestive tract morphogenesis	probable	GO:0048598, GO:0032502, GO:0009887, GO:0048562, GO:0048565, GO:0044707, GO:0048566, GO:0048568, GO:0032501, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0044699, GO:0048731, GO:0009653, GO:0048546, GO:0055123
GO:0009880 [BP]	embryonic pattern specification	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0060070 [BP]	canonical Wnt receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0035988 [BP]	chondrocyte proliferation	probable	GO:0008150, GO:0044699, GO:0008283
GO:0009952 [BP]	anterior/posterior pattern specification	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0007224 [BP]	smoothened signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:2000062 [BP]	negative regulation of ureter smooth muscle cell differentiation	probable	GO:1901861, GO:0051093, GO:0051239, GO:0050793, GO:0065007, GO:0048634, GO:2000061, GO:0008150, GO:0045596, GO:0051150, GO:0051151, GO:2000026, GO:0051147, GO:0048519, GO:0051148, GO:0050794, GO:0045595, GO:0050789, GO:0048523
GO:0032967 [BP]	positive regulation of collagen biosynthetic process	probable	GO:0010604, GO:0019222, GO:0009891, GO:0060255, GO:0051240, GO:0010714, GO:0009889, GO:0010712, GO:0032965, GO:0010557, GO:0010556, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0044253, GO:0050789, GO:0044246, GO:0009893
GO:0001947 [BP]	heart looping	probable	GO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009799, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007368, GO:0048513, GO:0048729, GO:0060562, GO:0061371, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0007507, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0007389, GO:0008150, GO:0035295, GO:0003143, GO:0044707, GO:0048856, GO:0044767, GO:0009855, GO:0048731
GO:0001948 [MF]	glycoprotein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0034244 [BP]	negative regulation of transcription elongation from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0034243, GO:0045934, GO:0019219, GO:0032784, GO:0009889, GO:0032785, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0090136 [BP]	epithelial cell-cell adhesion	probable	GO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0016331 [BP]	morphogenesis of embryonic epithelium	probable	GO:0048598, GO:0002009, GO:0048856, GO:0044707, GO:0060429, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0030178 [BP]	negative regulation of Wnt receptor signaling pathway	probable	GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0045471 [BP]	response to ethanol	probable	GO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033
GO:0007502 [BP]	digestive tract mesoderm development	probable	GO:0007498, GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0033088 [BP]	negative regulation of immature T cell proliferation in thymus	probable	GO:0042130, GO:0050868, GO:0050865, GO:0033081, GO:0050866, GO:0033084, GO:0050863, GO:0033087, GO:0045580, GO:0065007, GO:0032944, GO:0032945, GO:0050789, GO:0051249, GO:0070663, GO:0002682, GO:0070664, GO:0048519, GO:0002683, GO:0042127, GO:0008285, GO:0033083, GO:0050793, GO:0042129, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0051250, GO:0050670, GO:0050672, GO:0002695, GO:0002694, GO:1902105, GO:2000026, GO:0045619, GO:0048523
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048469 [BP]	cell maturation	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0010259, GO:0044699
GO:0031016 [BP]	pancreas development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0060916 [BP]	mesenchymal cell proliferation involved in lung development	probable	GO:0060541, GO:0032502, GO:0030323, GO:0030324, GO:0044707, GO:0008283, GO:0032501, GO:0048856, GO:0007275, GO:0044767, GO:0048513, GO:0008150, GO:0010463, GO:0048731, GO:0072089, GO:0035295, GO:0044699
GO:0001822 [BP]	kidney development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0007275, GO:0044699
GO:0032332 [BP]	positive regulation of chondrocyte differentiation	probable	GO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0032330, GO:0045595, GO:0061035, GO:2000026, GO:0008150, GO:0051239, GO:0048518, GO:0065007, GO:0050789, GO:0048522
GO:0072498 [BP]	embryonic skeletal joint development	probable	GO:0032502, GO:0048706, GO:0044707, GO:0009790, GO:0032501, GO:0048856, GO:0044767, GO:0001501, GO:0009792, GO:0008150, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0033085 [BP]	negative regulation of T cell differentiation in thymus	probable	GO:0050868, GO:0050865, GO:0033081, GO:0050866, GO:0050863, GO:0045580, GO:0045581, GO:0065007, GO:0050789, GO:0051249, GO:0002694, GO:0002682, GO:0002683, GO:0045620, GO:0050793, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0048519, GO:0051093, GO:0051250, GO:0002695, GO:1902106, GO:1902105, GO:2000026, GO:0045619, GO:0048523
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0071285 [BP]	cellular response to lithium ion	probable	GO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010226, GO:0010035, GO:0044699
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0002076 [BP]	osteoblast development	probable	GO:0032502, GO:0048856, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0044767, GO:0001503, GO:0044763, GO:0044699, GO:0008150, GO:0009987, GO:0001649
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0001570 [BP]	vasculogenesis	probable	GO:0032502, GO:0032501, GO:0048856, GO:0044707, GO:0008150, GO:0048869, GO:0001568, GO:0030154, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0044699, GO:0048731, GO:0044763, GO:0009987, GO:0009653, GO:0007275, GO:0048646
GO:0008233 [MF]	peptidase activity	probable	GO:0016787, GO:0003674, GO:0003824
GO:0001701 [BP]	in utero embryonic development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0030326 [BP]	embryonic limb morphogenesis	probable	GO:0048598, GO:0032502, GO:0035108, GO:0044707, GO:0060173, GO:0035107, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0044699, GO:0035113, GO:0009653, GO:0007275, GO:0048736, GO:0048856
GO:0043369 [BP]	CD4-positive or CD8-positive, alpha-beta T cell lineage commitment	probable	GO:0030154, GO:0042110, GO:0045321, GO:0007275, GO:0044699, GO:0045058, GO:0048869, GO:0008150, GO:0043368, GO:0048513, GO:0002360, GO:0048534, GO:0032502, GO:0032501, GO:0030217, GO:0009987, GO:0044767, GO:0001775, GO:0046649, GO:0044763, GO:0048731, GO:0002521, GO:0002520, GO:0045165, GO:0044707, GO:0048856, GO:0002376, GO:0030098, GO:0030097
GO:0006508 [BP]	proteolysis	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:2000358 [BP]	positive regulation of kidney smooth muscle cell differentiation	probable	GO:1901861, GO:0045597, GO:0051239, GO:0051094, GO:0050793, GO:2000356, GO:0090183, GO:0050794, GO:0051152, GO:0048518, GO:0051150, GO:2000026, GO:0008150, GO:0051147, GO:0051149, GO:0065007, GO:0045595, GO:0050789, GO:0048522
GO:1900180 [BP]	regulation of protein localization to nucleus	probable	GO:0060341, GO:0050794, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0032880
GO:2000357 [BP]	negative regulation of kidney smooth muscle cell differentiation	probable	GO:1901861, GO:0051093, GO:0051239, GO:0050793, GO:2000356, GO:0065007, GO:0090183, GO:0050794, GO:0008150, GO:0045596, GO:0051150, GO:0051151, GO:2000026, GO:0051147, GO:0048519, GO:0051148, GO:0045595, GO:0050789, GO:0048523
GO:0050679 [BP]	positive regulation of epithelial cell proliferation	probable	GO:0008284, GO:0042127, GO:0050678, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0034504 [BP]	protein localization to nucleus	probable	GO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0021521 [BP]	ventral spinal cord interneuron specification	probable	GO:0060573, GO:0021515, GO:0021514, GO:0021517, GO:0030154, GO:0021511, GO:0060579, GO:0021513, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0007389, GO:0048869, GO:0001708, GO:0008150, GO:0021953, GO:0032502, GO:0048665, GO:0048663, GO:0030182, GO:0009987, GO:0021510, GO:0060581, GO:0003002, GO:0048731, GO:0022008, GO:0048699, GO:0045165, GO:0009953, GO:0007399, GO:0044707, GO:0048856, GO:0044763
GO:0061053 [BP]	somite development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0006897 [BP]	endocytosis	probable	GO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0006029 [BP]	proteoglycan metabolic process	probable	GO:0044238, GO:0044260, GO:0019538, GO:1901135, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009100
GO:0005113 [MF]	patched binding	probable	GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0030336 [BP]	negative regulation of cell migration	probable	GO:0040013, GO:0051270, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0030334, GO:2000145, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0030900 [BP]	forebrain development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0046639 [BP]	negative regulation of alpha-beta T cell differentiation	probable	GO:0050868, GO:0046637, GO:0046636, GO:0046634, GO:0050863, GO:0045580, GO:0045581, GO:0065007, GO:0050789, GO:0051249, GO:0002694, GO:0050865, GO:0002682, GO:0002683, GO:0045620, GO:0050866, GO:0050793, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0048519, GO:0051093, GO:0051250, GO:0002695, GO:1902106, GO:1902105, GO:2000026, GO:0045619, GO:0048523
GO:0046638 [BP]	positive regulation of alpha-beta T cell differentiation	probable	GO:0046637, GO:0046635, GO:0046634, GO:0050863, GO:0045580, GO:0045582, GO:0050789, GO:0051249, GO:0050865, GO:0002684, GO:0002682, GO:0045621, GO:0065007, GO:0050867, GO:0050793, GO:0050870, GO:0050794, GO:0045597, GO:0048518, GO:0045595, GO:0008150, GO:0051239, GO:0051094, GO:0051251, GO:1902107, GO:0002694, GO:1902105, GO:0002696, GO:2000026, GO:0045619, GO:0048522
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0035264 [BP]	multicellular organism growth	probable	GO:0044699, GO:0032501, GO:0008150, GO:0040007, GO:0044707
GO:0007517 [BP]	muscle organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0060523 [BP]	prostate epithelial cord elongation	probable	GO:0048589, GO:0061458, GO:0060736, GO:0060737, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0000003, GO:0060442, GO:0030850, GO:0048513, GO:0048729, GO:0022612, GO:0060560, GO:0032502, GO:0009887, GO:0032501, GO:0048608, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0060740, GO:0060602, GO:0001655, GO:0048731, GO:0040007, GO:0044707, GO:0003006, GO:0048856, GO:0003401, GO:0008150, GO:0048732, GO:0060512
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030162 [BP]	regulation of proteolysis	probable	GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0008150, GO:0050789
GO:0031012 [CC]	extracellular matrix	probable	GO:0005575
GO:0051216 [BP]	cartilage development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0061448, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0003406 [BP]	retinal pigment epithelium development	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007423, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0048513, GO:0001654, GO:0060041, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0060323 [BP]	head morphogenesis	probable	GO:0032502, GO:0048856, GO:0044767, GO:0060322, GO:0008150, GO:0010171, GO:0009653, GO:0044699
GO:0003382 [BP]	epithelial cell morphogenesis	probable	GO:0032502, GO:0000904, GO:0000902, GO:0048869, GO:0071840, GO:0060429, GO:0048468, GO:0009888, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0044699, GO:0030855, GO:0030154, GO:0008150, GO:0009987, GO:0009653, GO:0002064, GO:0048856
GO:0014003 [BP]	oligodendrocyte development	probable	GO:0032502, GO:0044707, GO:0048856, GO:0021782, GO:0007399, GO:0009987, GO:0048709, GO:0030154, GO:0048468, GO:0042063, GO:0044767, GO:0032501, GO:0044763, GO:0008150, GO:0010001, GO:0048869, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0007417
GO:0005539 [MF]	glycosaminoglycan binding	probable	GO:0097367, GO:0003674, GO:0005488
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0048714 [BP]	positive regulation of oligodendrocyte differentiation	probable	GO:0048713, GO:0030154, GO:0045687, GO:0050789, GO:0045685, GO:0014015, GO:0014013, GO:0048869, GO:0060284, GO:0050769, GO:0008150, GO:0065007, GO:0044699, GO:0010720, GO:0048518, GO:0032502, GO:0032501, GO:0050767, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0030704 [BP]	vitelline membrane formation	probable	GO:0022607, GO:0019953, GO:0007292, GO:0048610, GO:0007276, GO:0044699, GO:0000003, GO:0016043, GO:0008150, GO:0044085, GO:0071840, GO:0043062, GO:0048477, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0022414, GO:0044763, GO:0022412, GO:0044702, GO:0030198, GO:0035803, GO:0085029
GO:0045453 [BP]	bone resorption	probable	GO:0032501, GO:0044707, GO:0048871, GO:0060249, GO:0048771, GO:0042592, GO:0008150, GO:0046849, GO:0065007, GO:0001894, GO:0065008, GO:0044699
GO:0061189 [BP]	positive regulation of sclerotome development	probable	GO:0051239, GO:0051094, GO:0050793, GO:0061190, GO:0008150, GO:2000026, GO:0045995, GO:0048518, GO:0065007, GO:0050789
GO:0060516 [BP]	primary prostatic bud elongation	probable	GO:0048589, GO:0061458, GO:0060736, GO:0060737, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0000003, GO:0030850, GO:0048513, GO:0048729, GO:0022612, GO:0060560, GO:0032502, GO:0009887, GO:0032501, GO:0048608, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0060740, GO:0060602, GO:0001655, GO:0048731, GO:0040007, GO:0044707, GO:0003006, GO:0048856, GO:0003401, GO:0008150, GO:0048732, GO:0060512
GO:0060220 [BP]	camera-type eye photoreceptor cell fate commitment	probable	GO:0046552, GO:0044707, GO:0030154, GO:0032501, GO:0060041, GO:0060042, GO:0009653, GO:0042706, GO:0044699, GO:0048869, GO:0007275, GO:0048513, GO:0032502, GO:0009887, GO:0009987, GO:0048663, GO:0030182, GO:0048592, GO:0048593, GO:0044767, GO:0008150, GO:0048731, GO:0060219, GO:0001754, GO:0022008, GO:0048699, GO:0045165, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0003407, GO:0001654, GO:0043010
GO:0004871 [MF]	signal transducer activity	probable	GO:0060089, GO:0003674
GO:0030133 [CC]	transport vesicle	probable	GO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0060738 [BP]	epithelial-mesenchymal signaling involved in prostate gland development	probable	GO:0048610, GO:0061458, GO:0023052, GO:0007275, GO:0044699, GO:0000003, GO:0030850, GO:0048513, GO:0060684, GO:0032502, GO:0032501, GO:0048608, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0001655, GO:0048731, GO:0007267, GO:0007154, GO:0044700, GO:0044707, GO:0003006, GO:0048856, GO:0008150, GO:0048732
GO:0040008 [BP]	regulation of growth	probable	GO:0008150, GO:0065007, GO:0050789
GO:0005576 [CC]	extracellular region	probable	GO:0005575
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0048666 [BP]	neuron development	probable	GO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0030010 [BP]	establishment of cell polarity	probable	GO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699
GO:0048745 [BP]	smooth muscle tissue development	probable	GO:0032502, GO:0048856, GO:0008150, GO:0009888, GO:0060537
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0042476 [BP]	odontogenesis	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0060135 [BP]	maternal process involved in female pregnancy	probable	GO:0044703, GO:0044702, GO:0048609, GO:0032504, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0051704, GO:0044699, GO:0000003
GO:2000223 [BP]	regulation of BMP signaling pathway involved in heart jogging	probable	GO:0090092, GO:0051239, GO:0022603, GO:0050793, GO:0048583, GO:0050794, GO:0008150, GO:0009966, GO:2000026, GO:2000027, GO:0045995, GO:0023051, GO:0065007, GO:0010646, GO:2000826, GO:0050789, GO:0030510

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K7I, chain B
Confidence level:very confident
Coverage over the Query: 7-109
View the alignment between query and template
View the model in PyMOL

Template: 1AT0, chain A
Confidence level:very confident
Coverage over the Query: 115-241
View the alignment between query and template
View the model in PyMOL