Diaphorina citri psyllid: psy16497

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MTPSHLILRWHRPNAKSILSDIEYTYAERVRVNDSIIVHKNGKAYVERVTRLENVIQTGVYAPLTTSGTIVVNNVFASCYAVIDNQFLAHLSFIPVRLYHSLVNLFSSNHIENSSHVTGIHWYPKLLYSMSDYFIPSAWMNND
cccccEEEEECccccccccccccEEEccccccccEEEEEEccEEEEEEEEEEEEEEEEEEECcccccccEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccccccccCEcHHHHHHHHccccccccccccc
MTPSHLILRWHRPNAKSILSDIEYTYAERVRVNDSIIVHKNGKAYVERVTRLENVIQTGVYAPLTTSGTIVVNNVFASCYAVIDNQFLAHLSFIPVRLYHSLVNLFSSNHIENSSHVTGIHWYPKLLYSMSDYFIPSAWMN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPSHLILRWHRPNAKSILSDIEYTYAERVRVNDSIIVHKNGKAYVERVTRLENVIQTGVYAPLTTSGTIVVNNVFASCYAVIDNQFLAHLSFIPVRLYHSLVNLFSSNHIENSSHVTGIHWYPKLLYSMSDYFIPSAWMNND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0010556 [BP]regulation of macromolecule biosynthetic processprobableGO:0019222, GO:0060255, GO:0009889, GO:0065007, GO:0008150, GO:0050789
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0007389 [BP]pattern specification processprobableGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AT0, chain A
Confidence level:very confident
Coverage over the Query: 1-81
View the alignment between query and template
View the model in PyMOL