Diaphorina citri psyllid: psy16510


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MMKIEKDIGALAISFVALFIAVVSAQRGPPQYAPGQFIPIISYQNEPNQGDGSYRYSYETGNGIAANEQGYLKNPGQKDLEAQTAQGQFTYTAPDGTPITVQWFADETGFHASGAHLPTPPPIPEAILKSLQQVQVSPPGPNRFGRK
cccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccccccEEEEEEcccccEEEEEEECcccccccccccEEEEEEEEEcccccEEEEEEEccccccCCccccccccccccHHHHHHHHHHHcccccccccccc
******DIGALAISFVALFIAVVSAQRGPPQYAPGQFIPIISYQNEPNQGDGSYRYSYETGNGIAA****************QTAQGQFTYTAPDGTPITVQWFADETGFHASGAHLPTPPPIPEAILKSLQQ**************
xxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKIEKDIGALAISFVALFIAVVSAQRGPPQYAPGQFIPIISYQNEPNQGDGSYRYSYETGNGIAANEQGYLKNPGQKDLEAQTAQGQFTYTAPDGTPITVQWFADETGFHASGAHLPTPPPIPEAILKSLQQVQVSPPGPNRFGRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005214 [MF]structural constituent of chitin-based cuticleprobableGO:0003674, GO:0042302, GO:0005198

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RD1, chain A
Confidence level:probable
Coverage over the Query: 55-102
View the alignment between query and template
View the model in PyMOL