Diaphorina citri psyllid: psy1651


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MNNPVYLVQNDRYYWISSEGDYIRHPVLYELSHKYGFITENVAEEALPNKLEELKEHIRKEIRKELKIKEGAEKLREVARDRKSLSDVATIVKKSNSKLSELHNELQELESQIIMTQGQTVTSPTAANHEHGKSSDFLSPF
ccccccEEEcccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
****VYLVQNDRYYWISSEGDYIRHPVLYELSHKYGFITENVAEEA***************IRKELKIKEGAEKLREVARDRKSLSDVATIVKKSNSKLSELHNELQEL********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNPVYLVQNDRYYWISSEGDYIRHPVLYELSHKYGFITENVAEEALPNKLEELKEHIRKEIRKELKIKEGAEKLREVARDRKSLSDVATIxxxxxxxxxxxxxxxxxxxxxxxxxxxxTVTSPTAANHEHGKSSDFLSPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase N2 Pkc-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. May play a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion and transcription activation signaling processes.confidentA7MBL8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0004672 [MF]protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CXZ, chain B
Confidence level:very confident
Coverage over the Query: 71-89
View the alignment between query and template
View the model in PyMOL