Diaphorina citri psyllid: psy16520


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
MWIENASGPCFKKERLGRYSGSNGQSSHLSNVDNETNIRMYKTMVTLNEMDKVMYESQRQGRISFYMTSSGEEGSHVGSAAALDPEDLVYAQYRETGVLMWRGFSVEQMIDQLYGNIGSSDKGKQMPVHYGSRQHHFVTISSPLATQLPQAVGSAYAYKLKKNEKVVIVYFGEGAAIVTMATPFQPQRRNSMEEMGSRPEGLAWVFQPLELTETTIGHHSTSDDSTAYRSKSEVQEYEINNNPILRFKTLLFKKKLWSEEQDEQIGHHSTSDDSTAYRSKSEVQEYEINNNPILRFKTLLFKKKLWSEKQDEQLKKESKQLVLNSIRISEKKLKPSWKEMFEDVYHEMPPHIR
cccccccccccccEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccEEEccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHHcccccEEEEEEcccccccccccccccccHHHHHHcccccccEEccccHHHHHHHHHcccEEEEEEEEccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccc
********PCFKKERLGRYSGSNGQSSHLSNVDNETNIRMYKTMVTLNEMDKVMYESQRQGRISFYMTSSGEEGSHVGSAAALDPEDLVYAQYRETGVLMWRGFSVEQMIDQLYGNIGSSDKGKQMPVHYGSRQHHFVTISSPLATQLPQAVGSAYAYKLKKNEKVVIVYFGEGAAIVTMATPFQPQRRNSMEEMGSRPEGLAWVFQPLELTETTIGHHSTSDDSTAYRSKSEVQEYEINNNPILRFKTLLFKKKLWSEEQDEQIGHHSTSDDSTAYRSKSEVQEYEINNNPILRFKTLLFKKKLWSEKQDEQLKKESKQLVLNSIRISEKKLKPSWKEMFEDVYHEMPPHI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWIENASGPCFKKERLGRYSGSNGQSSHLSNVDNETNIRMYKTMVTLNEMDKVMYESQRQGRISFYMTSSGEEGSHVGSAAALDPEDLVYAQYRETGVLMWRGFSVEQMIDQLYGNIGSSDKGKQMPVHYGSRQHHFVTISSPLATQLPQAVGSAYAYKLKKNEKVVIVYFGEGAAIVTMATPFQPQRRNSMEEMGSRPEGLAWVFQPLELTETTIGHHSTSDDSTAYRSKSEVQEYEINNNPILRFKTLLFKKKLWSEEQDEQIGHHSTSDDSTAYRSKSEVQEYEINNNPILRFKTLLFKKKLWSEKQDEQLKKESKQLVLNSIRISEKKLKPSWKEMFEDVYHEMPPHIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).confidentA5A6H9
2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3) (By similarity). Required for the production of the monomethyl branched-chain fatty acids (mmBCFAs) isopentadecanoate (C15iso) and isoheptadecanoate (C17iso).confidentO45924
2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).confidentP11960

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005947 [CC]mitochondrial alpha-ketoglutarate dehydrogenase complexprobableGO:0031974, GO:0043229, GO:0045240, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0005759, GO:0030062, GO:0045239, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0003826 [MF]alpha-ketoacid dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016491
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QS0, chain A
Confidence level:very confident
Coverage over the Query: 19-204,217-246,259-353
View the alignment between query and template
View the model in PyMOL
Template: 1QS0, chain A
Confidence level:very confident
Coverage over the Query: 3-177,194-266
View the alignment between query and template
View the model in PyMOL