Diaphorina citri psyllid: psy16528


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MNNNNVPTISSNMPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
cccccccccccccccccccHHHHHcccEEEEEccccHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHcccccc
**********************FYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNNNVPTISSNMPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative fatty acyl-CoA reductase CG5065 Catalyzes the reduction of saturated fatty acyl-CoA to fatty alcohols.confidentA1ZAI5
Fatty acyl-CoA reductase 1 Catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.confidentQ5ZM72
Fatty acyl-CoA reductase 2 Catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.confidentQ7TNT2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0080019 [MF]fatty-acyl-CoA reductase (alcohol-forming) activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0050062 [MF]long-chain-fatty-acyl-CoA reductase activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0009058 [BP]biosynthetic processprobableGO:0008150, GO:0008152
GO:0035336 [BP]long-chain fatty-acyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793, GO:0035337

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DQV, chain A
Confidence level:very confident
Coverage over the Query: 24-73
View the alignment between query and template
View the model in PyMOL