Psyllid ID: psy16528


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MNNNNVPTISSNMPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
cccccccccccccccccccHHHHHcccEEEEEccccHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHcccccc
cccccccccccccccccccHHHHHcccEEEEEccccHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHccccc
mnnnnvptissnmpapstpvsefyqnrsvfvtggtgFMGKVLVEKLLRScpgikniyllmrpkhgqdINGRLAEIINAPLDW
mnnnnvptissnmpapstPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
MNNNNVPTISSNMPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
**********************FYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEII******
**********************FYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
*********SSNMPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
*****************TPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoo
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNNNVPTISSNMPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPLDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
A1ZAI5 625 Putative fatty acyl-CoA r yes N/A 0.756 0.099 0.725 5e-23
Q5ZM72 515 Fatty acyl-CoA reductase yes N/A 0.743 0.118 0.540 2e-14
Q7ZXF5 515 Fatty acyl-CoA reductase N/A N/A 0.743 0.118 0.557 3e-14
Q7TNT2 515 Fatty acyl-CoA reductase yes N/A 0.743 0.118 0.508 5e-14
Q0P5J1 515 Fatty acyl-CoA reductase yes N/A 0.743 0.118 0.475 5e-13
Q960W6 516 Putative fatty acyl-CoA r no N/A 0.719 0.114 0.508 8e-13
Q96K12 515 Fatty acyl-CoA reductase yes N/A 0.768 0.122 0.460 1e-12
Q922J9 515 Fatty acyl-CoA reductase no N/A 0.743 0.118 0.475 2e-12
Q66H50 515 Fatty acyl-CoA reductase no N/A 0.743 0.118 0.475 2e-12
Q5R834 515 Fatty acyl-CoA reductase no N/A 0.743 0.118 0.475 2e-12
>sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 Back     alignment and function desciption
 Score =  106 bits (264), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 45/62 (72%), Positives = 56/62 (90%)

Query: 19  PVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINA 78
           P+++FY  RSVF+TGGTGFMGKVLVEKLLRSCP I+NIYLL+RPK GQ+++ RL E++NA
Sbjct: 118 PIAQFYAGRSVFITGGTGFMGKVLVEKLLRSCPEIRNIYLLIRPKRGQEVSARLTELLNA 177

Query: 79  PL 80
           PL
Sbjct: 178 PL 179




Catalyzes the reduction of saturated fatty acyl-CoA to fatty alcohols.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: nEC: 2
>sp|Q5ZM72|FACR1_CHICK Fatty acyl-CoA reductase 1 OS=Gallus gallus GN=FAR1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZXF5|FACR1_XENLA Fatty acyl-CoA reductase 1 OS=Xenopus laevis GN=far1 PE=2 SV=1 Back     alignment and function description
>sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 Back     alignment and function description
>sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 Back     alignment and function description
>sp|Q960W6|FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1 Back     alignment and function description
>sp|Q96K12|FACR2_HUMAN Fatty acyl-CoA reductase 2 OS=Homo sapiens GN=FAR2 PE=2 SV=1 Back     alignment and function description
>sp|Q922J9|FACR1_MOUSE Fatty acyl-CoA reductase 1 OS=Mus musculus GN=Far1 PE=1 SV=1 Back     alignment and function description
>sp|Q66H50|FACR1_RAT Fatty acyl-CoA reductase 1 OS=Rattus norvegicus GN=Far1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R834|FACR1_PONAB Fatty acyl-CoA reductase 1 OS=Pongo abelii GN=FAR1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
345489767 517 PREDICTED: putative fatty acyl-CoA reduc 0.878 0.139 0.698 2e-23
242012541 522 male sterility domain-containing protein 0.768 0.120 0.793 4e-23
383859001 516 PREDICTED: putative fatty acyl-CoA reduc 0.768 0.122 0.746 2e-22
307176727 606 Fatty acyl-CoA reductase 1 [Camponotus f 0.768 0.103 0.746 4e-22
157115700 531 hypothetical protein AaeL_AAEL007298 [Ae 0.743 0.114 0.754 8e-22
157115702 483 hypothetical protein AaeL_AAEL007298 [Ae 0.743 0.126 0.754 9e-22
195488129 624 GE11808 [Drosophila yakuba] gi|194178284 0.756 0.099 0.725 2e-21
194882463 624 GG20619 [Drosophila erecta] gi|190658517 0.756 0.099 0.725 2e-21
307211545 516 Fatty acyl-CoA reductase 1 [Harpegnathos 0.878 0.139 0.666 2e-21
24654209 625 CG5065, isoform A [Drosophila melanogast 0.756 0.099 0.725 2e-21
>gi|345489767|ref|XP_003426226.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like isoform 2 [Nasonia vitripennis] gi|345489769|ref|XP_001601849.2| PREDICTED: putative fatty acyl-CoA reductase CG5065-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/73 (69%), Positives = 61/73 (83%), Gaps = 1/73 (1%)

Query: 9  ISSNMPAPS-TPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQD 67
          +++ MP    T V EFY++RS+F+TGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPK GQ 
Sbjct: 1  MATTMPGVGYTSVKEFYRDRSIFITGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKRGQG 60

Query: 68 INGRLAEIINAPL 80
          +  RL E++NAPL
Sbjct: 61 VQQRLQELLNAPL 73




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242012541|ref|XP_002426991.1| male sterility domain-containing protein, putative [Pediculus humanus corporis] gi|212511220|gb|EEB14253.1| male sterility domain-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383859001|ref|XP_003704987.1| PREDICTED: putative fatty acyl-CoA reductase CG5065-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307176727|gb|EFN66142.1| Fatty acyl-CoA reductase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157115700|ref|XP_001652667.1| hypothetical protein AaeL_AAEL007298 [Aedes aegypti] gi|108876814|gb|EAT41039.1| AAEL007298-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|157115702|ref|XP_001652668.1| hypothetical protein AaeL_AAEL007298 [Aedes aegypti] gi|108876815|gb|EAT41040.1| AAEL007298-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195488129|ref|XP_002092183.1| GE11808 [Drosophila yakuba] gi|194178284|gb|EDW91895.1| GE11808 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194882463|ref|XP_001975330.1| GG20619 [Drosophila erecta] gi|190658517|gb|EDV55730.1| GG20619 [Drosophila erecta] Back     alignment and taxonomy information
>gi|307211545|gb|EFN87623.1| Fatty acyl-CoA reductase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|24654209|ref|NP_611143.1| CG5065, isoform A [Drosophila melanogaster] gi|281363509|ref|NP_001163168.1| CG5065, isoform B [Drosophila melanogaster] gi|281363511|ref|NP_001163169.1| CG5065, isoform C [Drosophila melanogaster] gi|386768124|ref|NP_001246370.1| CG5065, isoform D [Drosophila melanogaster] gi|386768126|ref|NP_001246371.1| CG5065, isoform E [Drosophila melanogaster] gi|238064958|sp|A1ZAI5.1|FACR1_DROME RecName: Full=Putative fatty acyl-CoA reductase CG5065 gi|7302902|gb|AAF57974.1| CG5065, isoform A [Drosophila melanogaster] gi|272432512|gb|ACZ94440.1| CG5065, isoform B [Drosophila melanogaster] gi|272432513|gb|ACZ94441.1| CG5065, isoform C [Drosophila melanogaster] gi|383302529|gb|AFH08123.1| CG5065, isoform D [Drosophila melanogaster] gi|383302530|gb|AFH08124.1| CG5065, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
FB|FBgn0034145 625 CG5065 [Drosophila melanogaste 0.756 0.099 0.725 5.9e-21
ZFIN|ZDB-GENE-040426-2908 464 far1 "fatty acyl CoA reductase 0.743 0.131 0.573 1.2e-14
FB|FBgn0033464 517 CG1441 [Drosophila melanogaste 0.682 0.108 0.625 2.6e-14
UNIPROTKB|Q5ZM72 515 FAR1 "Fatty acyl-CoA reductase 0.743 0.118 0.540 2.4e-13
UNIPROTKB|E1C023 517 FAR1 "Fatty acyl-CoA reductase 0.743 0.117 0.540 2.4e-13
ZFIN|ZDB-GENE-060503-367 515 si:dkey-97m3.1 "si:dkey-97m3.1 0.743 0.118 0.524 3.1e-13
UNIPROTKB|D4A2S1 503 Far2 "Protein Far2" [Rattus no 0.743 0.121 0.508 7.9e-13
MGI|MGI:2687035 515 Far2 "fatty acyl CoA reductase 0.743 0.118 0.508 8.3e-13
RGD|1565966 515 Far2 "fatty acyl CoA reductase 0.743 0.118 0.508 8.3e-13
UNIPROTKB|E1C6H7 511 FAR2 "Uncharacterized protein" 0.695 0.111 0.561 1.3e-12
FB|FBgn0034145 CG5065 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 255 (94.8 bits), Expect = 5.9e-21, P = 5.9e-21
 Identities = 45/62 (72%), Positives = 56/62 (90%)

Query:    19 PVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINA 78
             P+++FY  RSVF+TGGTGFMGKVLVEKLLRSCP I+NIYLL+RPK GQ+++ RL E++NA
Sbjct:   118 PIAQFYAGRSVFITGGTGFMGKVLVEKLLRSCPEIRNIYLLIRPKRGQEVSARLTELLNA 177

Query:    79 PL 80
             PL
Sbjct:   178 PL 179




GO:0080019 "fatty-acyl-CoA reductase (alcohol-forming) activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
ZFIN|ZDB-GENE-040426-2908 far1 "fatty acyl CoA reductase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0033464 CG1441 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM72 FAR1 "Fatty acyl-CoA reductase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C023 FAR1 "Fatty acyl-CoA reductase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-367 si:dkey-97m3.1 "si:dkey-97m3.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2S1 Far2 "Protein Far2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2687035 Far2 "fatty acyl CoA reductase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1565966 Far2 "fatty acyl CoA reductase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6H7 FAR2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A1ZAI5FACR1_DROME1, ., 2, ., 1, ., n, 20.72580.75600.0992yesN/A
Q7TNT2FACR2_MOUSE1, ., 2, ., 1, ., n, 20.50810.74390.1184yesN/A
Q5ZM72FACR1_CHICK1, ., 2, ., 1, ., n, 20.54090.74390.1184yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
cd05236 320 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (F 2e-23
pfam07993 245 pfam07993, NAD_binding_4, Male sterility protein 6e-17
PLN02503 605 PLN02503, PLN02503, fatty acyl-CoA reductase 2 4e-13
PLN02996 491 PLN02996, PLN02996, fatty acyl-CoA reductase 9e-12
cd05263 293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 5e-07
PRK07201 657 PRK07201, PRK07201, short chain dehydrogenase; Pro 1e-06
cd05235 290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 2e-05
COG3320 382 COG3320, COG3320, Putative dehydrogenase domain of 3e-05
cd05228 318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 7e-05
TIGR01746 367 TIGR01746, Thioester-redct, thioester reductase do 1e-04
cd05262 291 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 3e-04
TIGR03443 1389 TIGR03443, alpha_am_amid, L-aminoadipate-semialdeh 3e-04
COG0451 314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 3e-04
cd08946 200 cd08946, SDR_e, extended (e) SDRs 4e-04
COG1086 588 COG1086, COG1086, Predicted nucleoside-diphosphate 6e-04
cd05252 336 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata 6e-04
pfam01370 233 pfam01370, Epimerase, NAD dependent epimerase/dehy 0.002
TIGR02622 349 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydra 0.003
cd05237 287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 0.004
PLN02686 367 PLN02686, PLN02686, cinnamoyl-CoA reductase 0.004
>gnl|CDD|187547 cd05236, FAR-N_SDR_e, fatty acyl CoA reductases (FARs), extended (e) SDRs Back     alignment and domain information
 Score = 89.7 bits (223), Expect = 2e-23
 Identities = 32/54 (59%), Positives = 39/54 (72%)

Query: 27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIINAPL 80
          +SV +TG TGF+GKVL+EKLLRSCP I  IYLL+R K GQ    RL E++   L
Sbjct: 1  KSVLITGATGFLGKVLLEKLLRSCPDIGKIYLLIRGKSGQSAEERLRELLKDKL 54


SDRs are Rossmann-fold NAD(P)H-binding proteins, many of which may function as fatty acyl CoA reductases (FAR), acting on medium and long chain fatty acids, and have been reported to be involved in diverse processes such as biosynthesis of insect pheromones, plant cuticular wax production, and mammalian wax biosynthesis. In Arabidopsis thaliana, proteins with this particular architecture have also been identified as the MALE STERILITY 2 (MS2) gene product, which is implicated in male gametogenesis. Mutations in MS2 inhibit the synthesis of exine (sporopollenin), rendering plants unable to reduce pollen wall fatty acids to corresponding alcohols. This N-terminal domain shares the catalytic triad (but not the upstream Asn) and characteristic NADP-binding motif of the extended SDR family. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 320

>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2 Back     alignment and domain information
>gnl|CDD|215538 PLN02996, PLN02996, fatty acyl-CoA reductase Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|233557 TIGR01746, Thioester-redct, thioester reductase domain Back     alignment and domain information
>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 Back     alignment and domain information
>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|233954 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|215370 PLN02686, PLN02686, cinnamoyl-CoA reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
PLN02996 491 fatty acyl-CoA reductase 99.25
PLN02503 605 fatty acyl-CoA reductase 2 99.18
KOG1221|consensus 467 99.17
KOG1502|consensus 327 99.11
PF07993 249 NAD_binding_4: Male sterility protein; InterPro: I 98.84
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 98.84
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 98.83
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 98.83
PLN00198 338 anthocyanidin reductase; Provisional 98.74
PLN02572 442 UDP-sulfoquinovose synthase 98.74
COG3320 382 Putative dehydrogenase domain of multifunctional n 98.73
PLN02583 297 cinnamoyl-CoA reductase 98.73
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 98.71
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 98.7
CHL00194 317 ycf39 Ycf39; Provisional 98.7
PLN02206 442 UDP-glucuronate decarboxylase 98.69
PLN02214 342 cinnamoyl-CoA reductase 98.69
PLN02427 386 UDP-apiose/xylose synthase 98.68
TIGR01746 367 Thioester-redct thioester reductase domain. It has 98.67
PLN02650 351 dihydroflavonol-4-reductase 98.66
PLN02166 436 dTDP-glucose 4,6-dehydratase 98.66
PLN02653 340 GDP-mannose 4,6-dehydratase 98.65
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.64
PLN02695 370 GDP-D-mannose-3',5'-epimerase 98.63
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.62
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 98.62
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.61
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.6
PLN02896 353 cinnamyl-alcohol dehydrogenase 98.6
PLN02240 352 UDP-glucose 4-epimerase 98.59
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 98.58
PRK07523 255 gluconate 5-dehydrogenase; Provisional 98.57
PLN02686 367 cinnamoyl-CoA reductase 98.56
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 98.55
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 98.54
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 98.53
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 98.53
PRK06194 287 hypothetical protein; Provisional 98.52
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 98.51
PLN02778 298 3,5-epimerase/4-reductase 98.51
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.51
PRK12828 239 short chain dehydrogenase; Provisional 98.51
PRK05717 255 oxidoreductase; Validated 98.5
PRK08628 258 short chain dehydrogenase; Provisional 98.5
PRK07806 248 short chain dehydrogenase; Provisional 98.5
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 98.49
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.49
PRK12367 245 short chain dehydrogenase; Provisional 98.48
PRK07890 258 short chain dehydrogenase; Provisional 98.48
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.48
PRK09135 249 pteridine reductase; Provisional 98.48
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 98.48
PRK12829 264 short chain dehydrogenase; Provisional 98.47
PLN02253 280 xanthoxin dehydrogenase 98.47
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.47
PRK09186 256 flagellin modification protein A; Provisional 98.47
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.46
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 98.46
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.46
PRK06914 280 short chain dehydrogenase; Provisional 98.46
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.46
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.45
PRK07774 250 short chain dehydrogenase; Provisional 98.45
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 98.45
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 98.45
PRK06057 255 short chain dehydrogenase; Provisional 98.45
PRK06523 260 short chain dehydrogenase; Provisional 98.45
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 98.44
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.44
PLN02260 668 probable rhamnose biosynthetic enzyme 98.44
PRK08226 263 short chain dehydrogenase; Provisional 98.44
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 98.43
KOG1429|consensus 350 98.43
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 98.42
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.42
PRK06398 258 aldose dehydrogenase; Validated 98.42
PRK10675 338 UDP-galactose-4-epimerase; Provisional 98.41
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 98.41
PRK06138 252 short chain dehydrogenase; Provisional 98.4
PRK08589 272 short chain dehydrogenase; Validated 98.4
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 98.4
PRK08703 239 short chain dehydrogenase; Provisional 98.4
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 98.4
PRK06196 315 oxidoreductase; Provisional 98.39
PRK07067 257 sorbitol dehydrogenase; Provisional 98.39
PRK07577 234 short chain dehydrogenase; Provisional 98.39
PRK06841 255 short chain dehydrogenase; Provisional 98.39
PRK07814 263 short chain dehydrogenase; Provisional 98.39
PRK06197 306 short chain dehydrogenase; Provisional 98.38
PRK07856 252 short chain dehydrogenase; Provisional 98.38
PRK07063 260 short chain dehydrogenase; Provisional 98.38
PRK08278 273 short chain dehydrogenase; Provisional 98.37
PRK06128 300 oxidoreductase; Provisional 98.37
PRK06500 249 short chain dehydrogenase; Provisional 98.37
PRK05867 253 short chain dehydrogenase; Provisional 98.37
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 98.37
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.36
PRK06180 277 short chain dehydrogenase; Provisional 98.36
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.36
PRK06949 258 short chain dehydrogenase; Provisional 98.36
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.36
PRK05875 276 short chain dehydrogenase; Provisional 98.36
PRK07478 254 short chain dehydrogenase; Provisional 98.36
PRK07201 657 short chain dehydrogenase; Provisional 98.36
PRK08213 259 gluconate 5-dehydrogenase; Provisional 98.36
PRK06179 270 short chain dehydrogenase; Provisional 98.36
PRK07326 237 short chain dehydrogenase; Provisional 98.36
PRK06172 253 short chain dehydrogenase; Provisional 98.35
PRK09072 263 short chain dehydrogenase; Provisional 98.35
PRK08265 261 short chain dehydrogenase; Provisional 98.35
PRK12320 699 hypothetical protein; Provisional 98.35
PLN03209 576 translocon at the inner envelope of chloroplast su 98.35
PRK07060 245 short chain dehydrogenase; Provisional 98.34
PRK07062 265 short chain dehydrogenase; Provisional 98.34
PRK09291 257 short chain dehydrogenase; Provisional 98.34
PLN00016 378 RNA-binding protein; Provisional 98.34
PRK06701 290 short chain dehydrogenase; Provisional 98.34
PRK07035 252 short chain dehydrogenase; Provisional 98.34
COG0300 265 DltE Short-chain dehydrogenases of various substra 98.34
PRK06182 273 short chain dehydrogenase; Validated 98.34
PRK07102 243 short chain dehydrogenase; Provisional 98.33
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 98.33
PRK12827 249 short chain dehydrogenase; Provisional 98.33
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.33
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 98.33
PRK08263 275 short chain dehydrogenase; Provisional 98.33
PRK05876 275 short chain dehydrogenase; Provisional 98.32
PRK06114 254 short chain dehydrogenase; Provisional 98.32
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.32
PRK05866 293 short chain dehydrogenase; Provisional 98.32
PRK08085 254 gluconate 5-dehydrogenase; Provisional 98.31
PRK06482 276 short chain dehydrogenase; Provisional 98.31
PRK07985 294 oxidoreductase; Provisional 98.31
PRK07825 273 short chain dehydrogenase; Provisional 98.31
PRK08643 256 acetoin reductase; Validated 98.31
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.31
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.31
KOG1371|consensus 343 98.3
PRK12939 250 short chain dehydrogenase; Provisional 98.3
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.3
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.3
PRK05854 313 short chain dehydrogenase; Provisional 98.3
PRK08277 278 D-mannonate oxidoreductase; Provisional 98.29
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 98.29
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.29
PRK05993 277 short chain dehydrogenase; Provisional 98.28
PRK06124 256 gluconate 5-dehydrogenase; Provisional 98.28
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.28
PRK12746 254 short chain dehydrogenase; Provisional 98.28
PRK08339 263 short chain dehydrogenase; Provisional 98.28
PRK07453 322 protochlorophyllide oxidoreductase; Validated 98.28
PRK07576 264 short chain dehydrogenase; Provisional 98.28
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.28
PRK08264 238 short chain dehydrogenase; Validated 98.27
PRK12742 237 oxidoreductase; Provisional 98.27
PRK07074 257 short chain dehydrogenase; Provisional 98.27
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.26
PRK06101 240 short chain dehydrogenase; Provisional 98.26
PRK08251 248 short chain dehydrogenase; Provisional 98.26
PRK07023 243 short chain dehydrogenase; Provisional 98.26
PRK07904 253 short chain dehydrogenase; Provisional 98.25
PRK08177 225 short chain dehydrogenase; Provisional 98.25
PRK07454 241 short chain dehydrogenase; Provisional 98.25
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 98.24
PRK12747 252 short chain dehydrogenase; Provisional 98.24
PRK08219 227 short chain dehydrogenase; Provisional 98.24
PRK12937 245 short chain dehydrogenase; Provisional 98.24
PRK10538 248 malonic semialdehyde reductase; Provisional 98.24
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 98.23
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 98.23
PRK06924 251 short chain dehydrogenase; Provisional 98.23
PRK08267 260 short chain dehydrogenase; Provisional 98.23
PRK06483 236 dihydromonapterin reductase; Provisional 98.23
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 98.23
PRK07024 257 short chain dehydrogenase; Provisional 98.22
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 98.22
PRK08017 256 oxidoreductase; Provisional 98.22
PRK12744 257 short chain dehydrogenase; Provisional 98.21
PRK09134 258 short chain dehydrogenase; Provisional 98.21
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 98.21
PRK07775 274 short chain dehydrogenase; Provisional 98.21
PRK08936 261 glucose-1-dehydrogenase; Provisional 98.2
PRK05693 274 short chain dehydrogenase; Provisional 98.19
PRK09242 257 tropinone reductase; Provisional 98.19
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 98.18
PRK06181 263 short chain dehydrogenase; Provisional 98.18
PRK08303 305 short chain dehydrogenase; Provisional 98.18
PRK05872 296 short chain dehydrogenase; Provisional 98.17
PLN02780 320 ketoreductase/ oxidoreductase 98.17
PRK12935 247 acetoacetyl-CoA reductase; Provisional 98.17
PRK12938 246 acetyacetyl-CoA reductase; Provisional 98.17
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.16
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 98.16
PRK07097 265 gluconate 5-dehydrogenase; Provisional 98.15
PRK06198 260 short chain dehydrogenase; Provisional 98.15
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.14
PRK07109 334 short chain dehydrogenase; Provisional 98.14
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.14
PRK07677 252 short chain dehydrogenase; Provisional 98.13
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 98.12
PRK12743 256 oxidoreductase; Provisional 98.12
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 98.11
KOG1430|consensus 361 98.1
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 98.09
PRK06139 330 short chain dehydrogenase; Provisional 98.09
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 98.08
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 98.08
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 98.07
PRK06953 222 short chain dehydrogenase; Provisional 98.07
PRK06125 259 short chain dehydrogenase; Provisional 98.07
KOG1205|consensus 282 98.07
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.06
PRK05650 270 short chain dehydrogenase; Provisional 98.05
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.05
PRK07791 286 short chain dehydrogenase; Provisional 98.05
PRK09620 229 hypothetical protein; Provisional 98.04
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 98.04
PF00106 167 adh_short: short chain dehydrogenase alcohol dehyd 98.03
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.03
PRK08340 259 glucose-1-dehydrogenase; Provisional 98.03
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 98.03
PRK06720169 hypothetical protein; Provisional 98.03
PRK12824 245 acetoacetyl-CoA reductase; Provisional 98.03
PRK05865 854 hypothetical protein; Provisional 98.02
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 98.02
PRK07831 262 short chain dehydrogenase; Provisional 98.01
PRK07832 272 short chain dehydrogenase; Provisional 98.01
PRK07201 657 short chain dehydrogenase; Provisional 98.01
PRK09009 235 C factor cell-cell signaling protein; Provisional 98.01
PRK06123 248 short chain dehydrogenase; Provisional 98.0
PLN02260 668 probable rhamnose biosynthetic enzyme 98.0
PRK08862 227 short chain dehydrogenase; Provisional 98.0
PRK05884 223 short chain dehydrogenase; Provisional 97.99
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 97.99
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 97.98
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.97
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 97.97
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 97.97
TIGR02415 254 23BDH acetoin reductases. One member of this famil 97.97
PRK07578 199 short chain dehydrogenase; Provisional 97.96
PRK05855 582 short chain dehydrogenase; Validated 97.96
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 97.96
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.96
PRK06484 520 short chain dehydrogenase; Validated 97.95
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 97.95
PRK14982 340 acyl-ACP reductase; Provisional 97.94
PRK06947 248 glucose-1-dehydrogenase; Provisional 97.94
PRK07069 251 short chain dehydrogenase; Validated 97.94
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 97.93
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 97.93
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 97.93
smart00822 180 PKS_KR This enzymatic domain is part of bacterial 97.92
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.92
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 97.92
TIGR01830 239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 97.92
COG1028 251 FabG Dehydrogenases with different specificities ( 97.91
PRK08324 681 short chain dehydrogenase; Validated 97.9
PRK06484 520 short chain dehydrogenase; Validated 97.88
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 97.82
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.82
COG2910 211 Putative NADH-flavin reductase [General function p 97.82
KOG0725|consensus 270 97.81
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 97.8
TIGR01831 239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 97.79
KOG1431|consensus 315 97.77
COG1091 281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 97.77
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.77
PRK08309 177 short chain dehydrogenase; Provisional 97.73
PRK07041 230 short chain dehydrogenase; Provisional 97.67
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.65
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 97.64
PRK05599 246 hypothetical protein; Provisional 97.62
KOG1372|consensus 376 97.58
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 97.57
PF08659 181 KR: KR domain; InterPro: IPR013968 This domain is 97.57
KOG1208|consensus 314 97.56
KOG1201|consensus 300 97.55
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 97.52
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 97.49
KOG4169|consensus 261 97.48
PRK06940 275 short chain dehydrogenase; Provisional 97.48
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 97.47
KOG1014|consensus 312 97.4
PRK06732 229 phosphopantothenate--cysteine ligase; Validated 97.29
PRK12548 289 shikimate 5-dehydrogenase; Provisional 97.24
KOG1207|consensus 245 97.21
PLN00015 308 protochlorophyllide reductase 97.14
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 97.13
KOG1203|consensus 411 97.12
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.08
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 97.04
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.95
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 96.93
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 96.92
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.89
PLN02383 344 aspartate semialdehyde dehydrogenase 96.83
KOG1209|consensus 289 96.74
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 96.7
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 96.64
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 96.59
KOG1611|consensus 249 96.56
KOG4039|consensus 238 96.55
PRK00258 278 aroE shikimate 5-dehydrogenase; Reviewed 96.53
KOG1200|consensus 256 96.51
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 96.51
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 96.44
KOG1478|consensus 341 96.44
KOG0747|consensus 331 96.41
KOG2865|consensus 391 96.4
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.39
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 96.37
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.35
PRK05086 312 malate dehydrogenase; Provisional 96.3
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.3
PF04127 185 DFP: DNA / pantothenate metabolism flavoprotein; I 96.25
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.22
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.2
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.19
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.15
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.09
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.06
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 96.05
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.05
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.05
PRK08655 437 prephenate dehydrogenase; Provisional 96.04
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 95.91
PRK06849 389 hypothetical protein; Provisional 95.89
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 95.89
KOG1210|consensus 331 95.88
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.85
TIGR00507 270 aroE shikimate 5-dehydrogenase. This model finds p 95.84
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.79
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 95.75
PTZ00325 321 malate dehydrogenase; Provisional 95.74
PLN00106 323 malate dehydrogenase 95.72
TIGR02114 227 coaB_strep phosphopantothenate--cysteine ligase, s 95.7
cd01485 198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.61
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 95.6
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.54
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 95.51
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.49
PF02737 180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.48
cd08259 332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 95.47
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.47
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 95.47
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.39
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 95.38
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.33
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.31
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.27
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 95.25
COG2085 211 Predicted dinucleotide-binding enzymes [General fu 95.17
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.16
cd01492 197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.15
PRK09496 453 trkA potassium transporter peripheral membrane com 95.13
TIGR02825 325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 95.12
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 95.1
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.1
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 95.09
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 95.04
PRK00048 257 dihydrodipicolinate reductase; Provisional 95.03
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 95.0
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.0
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 94.99
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 94.98
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 94.95
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 94.95
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 94.93
PRK06444 197 prephenate dehydrogenase; Provisional 94.91
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 94.84
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 94.75
TIGR01809 282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.71
PRK05442 326 malate dehydrogenase; Provisional 94.7
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 94.63
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 94.61
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 94.51
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.48
PRK06719157 precorrin-2 dehydrogenase; Validated 94.46
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 94.46
PRK12549 284 shikimate 5-dehydrogenase; Reviewed 94.46
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 94.43
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 94.42
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.41
PRK14027 283 quinate/shikimate dehydrogenase; Provisional 94.34
cd05276 323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 94.33
cd08253 325 zeta_crystallin Zeta-crystallin with NADP-dependen 94.31
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 94.3
PRK08328 231 hypothetical protein; Provisional 94.29
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 94.25
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 94.22
PRK06901 322 aspartate-semialdehyde dehydrogenase; Provisional 94.19
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 94.17
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.17
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 94.09
cd08289 326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 94.08
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.08
PRK13243 333 glyoxylate reductase; Reviewed 94.08
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.07
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 94.02
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 93.98
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.95
KOG1199|consensus 260 93.94
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 93.93
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 93.92
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 93.9
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 93.87
KOG1198|consensus 347 93.84
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.83
cd08268 328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 93.81
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 93.8
PRK08818 370 prephenate dehydrogenase; Provisional 93.8
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 93.76
PRK08223 287 hypothetical protein; Validated 93.75
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 93.72
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 93.66
TIGR00243 389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 93.66
KOG1610|consensus 322 93.62
PLN02256 304 arogenate dehydrogenase 93.54
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 93.52
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.49
PRK08306296 dipicolinate synthase subunit A; Reviewed 93.46
cd08250 329 Mgc45594_like Mgc45594 gene product and other MDR 93.46
PRK06153 393 hypothetical protein; Provisional 93.43
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 93.32
TIGR02824 325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 93.31
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.3
PRK13940 414 glutamyl-tRNA reductase; Provisional 93.24
PRK07417 279 arogenate dehydrogenase; Reviewed 93.24
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.24
cd08266 342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 93.23
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.21
PRK15116 268 sulfur acceptor protein CsdL; Provisional 93.2
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 93.19
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 93.16
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.13
cd00755 231 YgdL_like Family of activating enzymes (E1) of ubi 93.11
cd05288 329 PGDH Prostaglandin dehydrogenases. Prostaglandins 93.1
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.08
PRK14031 444 glutamate dehydrogenase; Provisional 93.05
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.03
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 93.02
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 92.99
PRK12480 330 D-lactate dehydrogenase; Provisional 92.97
COG0289 266 DapB Dihydrodipicolinate reductase [Amino acid tra 92.96
cd08244 324 MDR_enoyl_red Possible enoyl reductase. Member ide 92.9
cd05280 325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 92.84
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.78
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.76
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 92.75
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 92.74
PTZ00117 319 malate dehydrogenase; Provisional 92.73
PRK09496 453 trkA potassium transporter peripheral membrane com 92.72
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.72
KOG4288|consensus 283 92.71
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.71
cd08238 410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 92.65
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 92.6
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 92.59
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.57
cd08292 324 ETR_like_2 2-enoyl thioester reductase (ETR) like 92.56
TIGR02817 336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 92.54
cd05295 452 MDH_like Malate dehydrogenase-like. These MDH-like 92.53
COG0743 385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 92.52
PRK13771 334 putative alcohol dehydrogenase; Provisional 92.5
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 92.49
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.46
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 92.46
PRK06223 307 malate dehydrogenase; Reviewed 92.45
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.43
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 92.41
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 92.38
cd08241 323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 92.36
cd08270 305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 92.33
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.33
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.33
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.32
COG0169 283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 92.19
cd05282 323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 92.18
TIGR00036 266 dapB dihydrodipicolinate reductase. 92.18
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.12
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 92.11
cd08246 393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 92.11
cd05289 309 MDR_like_2 alcohol dehydrogenase and quinone reduc 92.09
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 92.09
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 92.05
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 92.04
PRK00676 338 hemA glutamyl-tRNA reductase; Validated 92.03
PLN00203 519 glutamyl-tRNA reductase 92.02
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.99
cd08248 350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 91.98
cd08288 324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 91.95
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.94
cd08243 320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 91.91
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 91.91
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 91.89
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 91.89
cd01487 174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 91.85
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 91.84
PLN02928 347 oxidoreductase family protein 91.83
cd05286 320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 91.82
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
Probab=99.25  E-value=2.8e-11  Score=87.22  Aligned_cols=55  Identities=40%  Similarity=0.806  Sum_probs=48.8

Q ss_pred             ChhhhccCcEEEEEcCCChHHHHHHHHHHHhCCCcceEEEEeCCCCCccHHHHHH
Q psy16528         19 PVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLA   73 (82)
Q Consensus        19 ~~~~~~~~~~ilItG~tG~iG~~i~~~l~~~g~~~~~V~~l~r~~~~~~~~~~~~   73 (82)
                      .+.+++++++|+|||||||+|+++++.|++.+.++.+|+++.|........+++.
T Consensus         4 ~i~~~~~~k~VlvTGaTGFlG~~ll~~LL~~~~~v~~I~~LvR~~~~~~~~~rl~   58 (491)
T PLN02996          4 SCVQFLENKTILVTGATGFLAKIFVEKILRVQPNVKKLYLLLRASDAKSATQRLH   58 (491)
T ss_pred             cHHHHhCCCeEEEeCCCcHHHHHHHHHHHhhCCCCCEEEEEEeCCCCCCHHHHHH
Confidence            4667899999999999999999999999998778889999999888777777764



>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>KOG4039|consensus Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG4288|consensus Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
4dqv_A 478 Crystal Structure Of Reductase (R) Domain Of Non-Ri 5e-04
>pdb|4DQV|A Chain A, Crystal Structure Of Reductase (R) Domain Of Non-Ribosomal Peptide Synthetase From Mycobacterium Tuberculosis Length = 478 Back     alignment and structure

Iteration: 1

Score = 39.7 bits (91), Expect = 5e-04, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Query: 12 NMPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGR 71 N+P PS + R+V +TG TGF+G+ LV +LLR + L+R + +D R Sbjct: 65 NLPGPSPEL------RTVLLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRR 118 Query: 72 LAEIINA 78 L + ++ Sbjct: 119 LEKTFDS 125

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 3e-15
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 1e-05
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 6e-05
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 8e-05
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 1e-04
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 3e-04
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 3e-04
1xq6_A 253 Unknown protein; structural genomics, protein stru 6e-04
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
 Score = 67.6 bits (165), Expect = 3e-15
 Identities = 18/71 (25%), Positives = 33/71 (46%)

Query: 10  SSNMPAPSTPVSEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDIN 69
           +  +           + R+V +TG TGF+G+ LV +LLR       +  L+R +  +D  
Sbjct: 57  ADTLATAVNLPGPSPELRTVLLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDAR 116

Query: 70  GRLAEIINAPL 80
            RL +  ++  
Sbjct: 117 RRLEKTFDSGD 127


>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Length = 344 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 99.1
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 98.97
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 98.92
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 98.92
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 98.91
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 98.9
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 98.89
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 98.88
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 98.88
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 98.88
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 98.86
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 98.86
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 98.84
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 98.83
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 98.82
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 98.82
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 98.82
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 98.82
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 98.82
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 98.82
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 98.82
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 98.81
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 98.8
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.8
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 98.79
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 98.79
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 98.79
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 98.79
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 98.78
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.78
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 98.77
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 98.77
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 98.77
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 98.77
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 98.77
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 98.76
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 98.76
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 98.76
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 98.76
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 98.76
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 98.75
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 98.74
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.72
4f6c_A 427 AUSA reductase domain protein; thioester reductase 98.72
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.72
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 98.7
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.7
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 98.7
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 98.7
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 98.7
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 98.69
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 98.69
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 98.69
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 98.69
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 98.69
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 98.69
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 98.68
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 98.67
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 98.67
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 98.67
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.67
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 98.66
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 98.66
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 98.66
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 98.65
1xq6_A 253 Unknown protein; structural genomics, protein stru 98.65
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 98.65
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 98.65
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 98.65
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 98.65
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 98.65
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 98.65
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 98.64
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 98.64
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 98.64
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 98.64
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 98.64
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.64
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.64
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 98.64
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 98.64
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.64
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 98.63
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 98.63
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 98.63
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 98.63
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 98.63
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 98.63
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 98.62
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 98.62
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 98.62
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 98.62
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.62
4f6l_B 508 AUSA reductase domain protein; thioester reductase 98.62
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 98.62
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.62
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 98.62
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.62
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 98.61
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 98.61
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 98.61
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 98.61
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 98.61
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 98.61
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 98.61
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 98.61
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 98.61
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.6
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 98.6
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 98.6
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 98.6
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 98.6
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 98.6
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 98.6
1xq1_A 266 Putative tropinone reducatse; structural genomics, 98.6
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 98.6
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.59
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 98.59
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 98.59
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 98.59
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 98.59
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 98.59
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 98.59
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 98.59
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 98.59
3cxt_A 291 Dehydrogenase with different specificities; rossma 98.59
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 98.59
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 98.59
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 98.59
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 98.58
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 98.58
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.58
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 98.58
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.58
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 98.58
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.58
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 98.57
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.57
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 98.57
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 98.57
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 98.57
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 98.57
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 98.57
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 98.57
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 98.57
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 98.56
3rih_A 293 Short chain dehydrogenase or reductase; structural 98.56
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.56
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 98.56
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 98.56
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 98.56
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.56
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 98.56
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 98.56
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 98.56
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 98.56
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 98.55
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.55
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 98.55
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 98.55
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 98.55
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 98.55
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 98.55
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 98.54
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 98.54
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 98.54
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 98.54
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 98.54
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 98.54
3imf_A 257 Short chain dehydrogenase; structural genomics, in 98.54
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 98.54
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 98.54
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 98.54
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 98.54
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 98.53
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 98.53
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 98.53
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.53
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 98.53
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 98.53
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 98.53
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 98.53
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 98.52
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.52
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.52
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 98.52
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 98.52
1spx_A 278 Short-chain reductase family member (5L265); paral 98.52
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 98.52
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.52
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.52
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 98.52
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.52
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 98.52
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 98.52
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 98.51
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 98.51
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 98.51
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 98.51
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 98.51
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 98.51
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 98.51
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 98.51
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.5
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 98.5
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 98.5
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 98.5
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 98.5
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.5
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 98.5
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.5
4dqx_A 277 Probable oxidoreductase protein; structural genomi 98.5
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 98.5
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 98.49
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 98.49
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 98.49
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.49
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 98.49
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.49
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 98.49
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 98.49
1xkq_A 280 Short-chain reductase family member (5D234); parra 98.49
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 98.49
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.49
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 98.48
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 98.48
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 98.48
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.48
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 98.48
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.48
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 98.48
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 98.47
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.47
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 98.47
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.47
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.47
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 98.46
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 98.46
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 98.46
1xhl_A 297 Short-chain dehydrogenase/reductase family member 98.45
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 98.45
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 98.45
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 98.45
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 98.45
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.44
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.44
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 98.43
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.43
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 98.43
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.43
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 98.43
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 98.42
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 98.42
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 98.42
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 98.42
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 98.41
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.41
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 98.41
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.41
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 98.41
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 98.4
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 98.4
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.4
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.4
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.39
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 98.39
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 98.38
4e4y_A 244 Short chain dehydrogenase family protein; structur 98.38
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 98.37
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 98.37
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 98.36
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 98.36
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 98.35
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.35
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 98.35
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 98.35
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 98.34
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.34
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 98.33
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 98.33
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 98.3
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 98.3
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 98.29
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 98.27
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.26
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 98.26
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 98.25
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 98.24
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 98.23
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.22
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 98.21
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 98.2
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 98.18
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 98.18
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 98.15
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.12
2yut_A 207 Putative short-chain oxidoreductase; alpha and bet 98.12
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 98.1
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 98.1
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 98.1
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.08
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 98.07
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.05
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.05
2gk4_A 232 Conserved hypothetical protein; alpha-beta-alpha s 98.02
1u7z_A 226 Coenzyme A biosynthesis bifunctional protein coabc 98.0
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 97.82
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 97.72
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.69
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 97.65
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.6
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 97.6
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 97.6
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.57
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.54
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 97.53
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.53
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.49
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.42
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.41
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 97.41
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 97.37
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 97.35
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.3
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 97.3
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 97.28
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.26
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.23
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.2
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.16
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.15
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 97.15
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.14
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 97.12
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.08
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.06
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.04
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 96.98
4eye_A 342 Probable oxidoreductase; structural genomics, niai 96.91
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 96.89
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 96.89
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 96.88
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 96.85
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 96.83
3gms_A 340 Putative NADPH:quinone reductase; structural genom 96.81
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 96.8
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 96.78
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 96.77
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.75
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.74
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 96.73
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 96.72
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.66
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 96.65
1p77_A 272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.65
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 96.62
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.6
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 96.58
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 96.57
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 96.57
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.56
3jyo_A 283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.53
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 96.53
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 96.52
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 96.49
1p9o_A 313 Phosphopantothenoylcysteine synthetase; ligase; 2. 96.48
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.46
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 96.37
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 96.32
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 96.31
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.27
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 96.27
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 96.26
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.25
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 96.23
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 96.22
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 96.2
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 96.18
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 96.18
3o8q_A 281 Shikimate 5-dehydrogenase I alpha; structural geno 96.18
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.17
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.17
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 96.11
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 96.09
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 96.07
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 96.04
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 96.03
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 96.03
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 95.97
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 95.93
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 95.93
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 95.89
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 95.88
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.88
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.87
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.87
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 95.85
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 95.85
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 95.84
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.83
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 95.83
2duw_A145 Putative COA-binding protein; ligand binding prote 95.79
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 95.78
2egg_A 297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.76
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 95.75
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 95.74
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 95.73
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 95.73
3p2o_A285 Bifunctional protein fold; structural genomics, ce 95.67
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.6
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 95.58
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.54
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 95.51
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 95.48
1vkn_A 351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 95.47
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 95.47
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.46
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 95.45
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.42
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 95.36
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 95.34
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 95.32
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.24
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 95.24
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 95.23
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.2
3l07_A285 Bifunctional protein fold; structural genomics, ID 95.18
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 95.15
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 95.13
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 95.13
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.13
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 95.12
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 95.1
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 95.05
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 95.05
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 95.04
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 95.03
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 95.01
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.98
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.96
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.96
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 94.94
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 94.92
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 94.9
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 94.89
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 94.87
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 94.86
2d59_A144 Hypothetical protein PH1109; COA binding, structur 94.84
1iuk_A140 Hypothetical protein TT1466; structural genomics, 94.79
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 94.78
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 94.76
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 94.75
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 94.72
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 94.68
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 94.67
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 94.65
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 94.63
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 94.61
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 94.61
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 94.59
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 94.57
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 94.57
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 94.46
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 94.45
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 94.44
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 94.43
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 94.43
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 94.41
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 94.38
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.35
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 94.35
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.26
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 94.22
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 94.22
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 94.19
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 94.17
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 94.16
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 94.16
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 94.15
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.15
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 94.14
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 94.14
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.11
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 94.11
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 94.09
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 94.06
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.02
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 94.01
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 94.0
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 93.99
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 93.96
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 93.92
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 93.91
3tl2_A 315 Malate dehydrogenase; center for structural genomi 93.91
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 93.9
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 93.89
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 93.88
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 93.87
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 93.85
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 93.84
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
Probab=99.10  E-value=1.4e-10  Score=76.42  Aligned_cols=36  Identities=33%  Similarity=0.483  Sum_probs=32.9

Q ss_pred             cEEEEEcCCChHHHHHHHHHHHhCCCcceEEEEeCCCCC
Q psy16528         27 RSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHG   65 (82)
Q Consensus        27 ~~ilItG~tG~iG~~i~~~l~~~g~~~~~V~~l~r~~~~   65 (82)
                      |+|||||||||||++++++|+++|+   +|++++|++..
T Consensus         1 MkILVTGatGfIG~~L~~~L~~~G~---~V~~l~R~~~~   36 (298)
T 4b4o_A            1 MRVLVGGGTGFIGTALTQLLNARGH---EVTLVSRKPGP   36 (298)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTTC---EEEEEESSCCT
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC---EEEEEECCCCc
Confidence            5799999999999999999999999   89999997543



>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 82
d1rkxa_ 356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 3e-06
d2bkaa1 232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 1e-05
d2q46a1 252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 2e-05
d2fr1a1 259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 2e-05
d1y1pa1 342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 3e-05
d1xgka_ 350 c.2.1.2 (A:) Negative transcriptional regulator Nm 5e-05
d1oc2a_ 346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 6e-05
d1g0oa_ 272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 1e-04
d1qyda_ 312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 2e-04
d1qyca_ 307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 2e-04
d1rpna_ 321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 3e-04
d1i24a_ 393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 4e-04
d2c5aa1 363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 4e-04
d1hdoa_ 205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 5e-04
d2blla1 342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 6e-04
d2a35a1 212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 7e-04
d2b69a1 312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 8e-04
d1e6ua_ 315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 0.001
d1r6da_ 322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 0.001
d1n7ha_ 339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 0.001
d1db3a_ 357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 0.001
d1orra_ 338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 0.002
d1udca_ 338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 0.002
d1kewa_ 361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 0.002
d1eq2a_ 307 c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimer 0.002
d1gy8a_ 383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 0.002
d1ek6a_ 346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 0.002
d1z45a2 347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 0.002
d1sb8a_ 341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 0.003
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: CDP-glucose-4,6-dehydratase
species: Yersinia pseudotuberculosis [TaxId: 633]
 Score = 41.0 bits (94), Expect = 3e-06
 Identities = 17/57 (29%), Positives = 24/57 (42%)

Query: 21 SEFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKHGQDINGRLAEIIN 77
          + F+Q + VFVTG TGF G  L   L      +K   L            R+A+ + 
Sbjct: 3  NSFWQGKRVFVTGHTGFKGGWLSLWLQTMGATVKGYSLTAPTVPSLFETARVADGMQ 59


>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Length = 307 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.23
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.09
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 99.09
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.05
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.02
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.02
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.01
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.99
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.98
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.98
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 98.94
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 98.92
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.92
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.91
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.91
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.9
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.89
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.88
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.88
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 98.88
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.87
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.87
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.85
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.83
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.82
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.79
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.74
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.74
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.72
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.71
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 98.69
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 98.66
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.65
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 98.65
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.65
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.65
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.63
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.61
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 98.6
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.59
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 98.58
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.58
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.55
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.54
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 98.54
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 98.53
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.53
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 98.52
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 98.52
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.51
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.51
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.51
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 98.51
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 98.5
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 98.5
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.5
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 98.5
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 98.49
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 98.49
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 98.49
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 98.48
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.48
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.48
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 98.48
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 98.48
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.47
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.47
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.47
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 98.47
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.47
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.46
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.46
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 98.46
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 98.45
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 98.45
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 98.43
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.38
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.38
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 98.37
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 98.37
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 98.34
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.31
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.3
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 98.23
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.2
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.18
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.16
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 98.13
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 98.07
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 98.04
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.02
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.98
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 97.88
d1e5qa1 182 Saccharopine reductase {Rice blast fungus (Magnapo 97.84
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.82
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 97.8
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.78
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 97.69
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 97.65
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.57
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.54
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.46
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.45
d1ks9a2 167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.42
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.42
d1vkna1 176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.37
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 97.32
d2cvoa1 183 Putative semialdehyde dehydrogenase {Rice (Oryza s 97.3
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.24
d2g17a1 179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.16
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 97.04
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.98
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.98
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 96.97
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.94
d1vi2a1 182 Putative shikimate dehydrogenase YdiB {Escherichia 96.94
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.92
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.91
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.89
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.76
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.65
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.63
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.62
d2f1ka2 165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.62
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.61
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.46
d1pqwa_ 183 Putative enoyl reductase domain of polyketide synt 96.46
d2g5ca2 171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.39
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 96.38
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.37
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.32
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.31
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.31
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.3
d1u7za_ 223 Coenzyme A biosynthesis bifunctional protein CoaBC 96.28
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.23
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 96.23
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.21
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 96.19
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.14
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.08
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 96.07
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.05
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.95
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.95
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.91
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.84
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.82
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.75
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.73
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 95.72
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 95.68
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.66
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.63
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.61
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.61
d1gu7a2 189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.55
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.53
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.5
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.36
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.35
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.34
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.33
d1p77a1 171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.28
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.28
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.25
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.15
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.11
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 95.09
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.05
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.01
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.0
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 94.98
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.97
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.91
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 94.83
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.81
d1diha1 162 Dihydrodipicolinate reductase {Escherichia coli [T 94.79
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 94.76
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 94.73
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 94.73
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.7
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.7
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.66
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.62
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.62
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.51
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 94.49
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.43
d1vj1a2 187 Putative zinc-binding alcohol dehydrogenase {Mouse 94.4
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.3
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.29
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.26
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.25
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 94.15
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.14
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.03
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 93.97
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.94
d1vpda2 161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.88
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.77
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.75
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.71
d1nvta1 177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 93.68
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.66
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 93.65
d1txga2 180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.64
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.6
d3cuma2 162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 93.51
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.36
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.32
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.23
d1nhpa1 198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.18
d1f06a1 170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 93.1
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.05
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 92.98
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 92.81
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.79
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.78
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 92.77
d1pgja2 178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.77
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.7
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 92.57
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 92.35
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 92.23
d2pgda2 176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 92.23
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 92.16
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.15
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.08
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 92.08
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.01
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 91.97
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.96
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 91.7
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 91.61
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 91.48
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.44
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 91.35
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 91.27
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.17
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus 91.04
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 90.99
d1m6ia1 213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 90.96
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 90.61
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 90.48
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 90.44
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 90.26
d1d7ya1 183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.24
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 90.22
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 90.21
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 90.18
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.01
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 89.71
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 89.47
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.13
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 89.1
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 88.88
d1n1ea2 189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 88.79
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 87.45
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 87.11
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 86.86
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 86.56
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 86.51
d1p3y1_ 183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 86.5
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 85.66
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 85.5
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 85.47
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 85.46
d1b7go1 178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.46
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 84.85
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 84.84
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.65
d3bswa1 193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 84.57
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 83.94
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 83.94
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 83.76
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 83.44
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 83.36
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 83.35
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 82.22
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 81.79
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 81.2
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 80.73
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 80.59
d1xhca1 167 NADH oxidase /nitrite reductase {Pyrococcus furios 80.4
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: CDP-glucose-4,6-dehydratase
species: Yersinia pseudotuberculosis [TaxId: 633]
Probab=99.23  E-value=8e-12  Score=81.98  Aligned_cols=40  Identities=33%  Similarity=0.367  Sum_probs=36.7

Q ss_pred             hhccCcEEEEEcCCChHHHHHHHHHHHhCCCcceEEEEeCCCC
Q psy16528         22 EFYQNRSVFVTGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKH   64 (82)
Q Consensus        22 ~~~~~~~ilItG~tG~iG~~i~~~l~~~g~~~~~V~~l~r~~~   64 (82)
                      ++|++|+|||||||||||++++++|++.|+   .|++++|...
T Consensus         4 ~~~~~KkILVTG~tGfIGs~lv~~Ll~~g~---~V~~~~r~~~   43 (356)
T d1rkxa_           4 SFWQGKRVFVTGHTGFKGGWLSLWLQTMGA---TVKGYSLTAP   43 (356)
T ss_dssp             HHHTTCEEEEETTTSHHHHHHHHHHHHTTC---EEEEEESSCS
T ss_pred             hhhCCCEEEEECCCCHHHHHHHHHHHHCCC---EEEEEECCCC
Confidence            468999999999999999999999999998   8999998654



>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure