Diaphorina citri psyllid: psy16529


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
VKAEKTHNALIEGVEAFDTAKLKHAETQEKNPLPDKDGTKKKPISKCTSYEDKKSKEKLISGIENFDTGKLKHTETVEKNPLPTKEAIDLEKKA
cHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHc
*********************************************************************************LPTK*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VKAEKTHNALIEGVEAFDTAKLKHAETQEKNPLPDKDGTKKKPISKCTSYEDKKSKEKLISGIENFDTGKLKHTETVEKNPLPTKEAIDLEKKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thymosin beta-4 Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase.confidentP34032
Thymosin beta-4 Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase.confidentP62327
Thymosin beta-4 Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase.confidentP62326

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003785 [MF]actin monomer bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0008064 [BP]regulation of actin polymerization or depolymerizationprobableGO:0030832, GO:0065008, GO:0033043, GO:0071840, GO:0032970, GO:0051493, GO:0016043, GO:0090066, GO:0051128, GO:0065007, GO:0044763, GO:0044699, GO:0032956, GO:0008150, GO:0009987, GO:0050794, GO:0050789, GO:0032535
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030334 [BP]regulation of cell migrationprobableGO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0051179 [BP]localizationprobableGO:0008150
GO:0007010 [BP]cytoskeleton organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0035193 [BP]larval central nervous system remodelingprobableGO:0032502, GO:0009886, GO:0044707, GO:0007399, GO:0048856, GO:0009791, GO:0002165, GO:0032501, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U9Z, chain C
Confidence level:confident
Coverage over the Query: 5-24
View the alignment between query and template
View the model in PyMOL
Template: 3SJH, chain B
Confidence level:confident
Coverage over the Query: 56-74
View the alignment between query and template
View the model in PyMOL