Diaphorina citri psyllid: psy16551


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MPEESTLSFNQYADRIYSVRFILGLKPSGNVIYRNSPRSVVKDLRSGDRVSRVNIRKKRPPDEGVISLIYIFFCRENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKWGPHGYGFAAGSGFLQTDGLTEDEISANRPFYNPNTTSIMARKGEGCPRCGGAVFAAEQQLAKGTMWHKQCFSCNVCKRPLDSVLACDGPDKEIYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQ
cccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccc
********FNQYADRIYSVRFILGLKPSGNVIYRN***************************EGVISLIYIFFCRE*******************KGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKWGPHGYGFAAGSGFLQTDGLTEDEISANRPFYNPNTTSIMARKGEGCPRCGGAVFAAEQQLAKGTMWHKQCFSCNVCKRPLDSVLACDGPDKEIYCKACYGKNFGPKGFGYGHS*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEESTLSFNQYADRIYSVRFILGLKPSGNVIYRNSPRSVVKDLRSGDRVSRVNIRKKRPPDEGVISLIYIFFCRENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKWGPHGYGFAAGSGFLQTDGLTEDEISANRPFYNPNTTSIMARKGEGCPRCGGAVFAAEQQLAKGTMWHKQCFSCNVCKRPLDSVLACDGPDKEIYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Muscle LIM protein Mlp84B Plays a role in cell differentiation late in myogenesis. Transcription factor Mef2 is essential for expression.confidentQ24400
Cysteine and glycine-rich protein 2 Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.confidentQ62908
Cysteine and glycine-rich protein 2 Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.confidentP97314

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0045214 [BP]sarcomere organizationprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0090175 [BP]regulation of establishment of planar polarityprobableGO:0022603, GO:0050793, GO:0008150, GO:2000026, GO:2000027, GO:0051239, GO:0065007, GO:0050789
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0014706 [BP]striated muscle tissue developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888, GO:0060537
GO:0003008 [BP]system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042805 [MF]actinin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B8T, chain A
Confidence level:very confident
Coverage over the Query: 95-254
View the alignment between query and template
View the model in PyMOL