Psyllid ID: psy16551
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 281 | ||||||
| 307182443 | 563 | Muscle LIM protein Mlp84B [Camponotus fl | 0.683 | 0.341 | 0.840 | 1e-97 | |
| 160333386 | 494 | muscle LIM protein isoform 1 [Bombyx mor | 0.718 | 0.408 | 0.833 | 1e-97 | |
| 242019568 | 492 | muscle lim protein, putative [Pediculus | 0.697 | 0.398 | 0.836 | 3e-97 | |
| 357619549 | 516 | muscle LIM protein isoform 1 [Danaus ple | 0.693 | 0.377 | 0.845 | 3e-97 | |
| 307205016 | 472 | Muscle LIM protein Mlp84B [Harpegnathos | 0.690 | 0.411 | 0.840 | 3e-97 | |
| 332373454 | 490 | unknown [Dendroctonus ponderosae] | 0.704 | 0.404 | 0.826 | 1e-96 | |
| 322797391 | 401 | hypothetical protein SINV_16490 [Solenop | 0.690 | 0.483 | 0.835 | 1e-96 | |
| 332027513 | 560 | Muscle LIM protein Mlp84B [Acromyrmex ec | 0.672 | 0.337 | 0.830 | 1e-96 | |
| 328788697 | 493 | PREDICTED: muscle LIM protein Mlp84B-lik | 0.697 | 0.397 | 0.839 | 1e-96 | |
| 383854456 | 493 | PREDICTED: muscle LIM protein Mlp84B-lik | 0.704 | 0.401 | 0.835 | 2e-96 |
| >gi|307182443|gb|EFN69678.1| Muscle LIM protein Mlp84B [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 362 bits (929), Expect = 1e-97, Method: Compositional matrix adjust.
Identities = 169/201 (84%), Positives = 184/201 (91%)
Query: 77 NNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSIN 136
+ APRTTVIDTA IKA PGKGCPRCGGVVFAAEQVLAKG EWHRKC+KC DC KTLDSI
Sbjct: 267 DAAPRTTVIDTAIIKAPPGKGCPRCGGVVFAAEQVLAKGREWHRKCYKCHDCTKTLDSII 326
Query: 137 ACDGPDKDIYCKTCYGKKWGPHGYGFAAGSGFLQTDGLTEDEISANRPFYNPNTTSIMAR 196
ACDGPD+D+YCKTCYGKKWGPHGYGFA GSGFLQTDGLTE+EISANRPFYNP+TTSI A
Sbjct: 327 ACDGPDRDVYCKTCYGKKWGPHGYGFACGSGFLQTDGLTEEEISANRPFYNPDTTSIKAP 386
Query: 197 KGEGCPRCGGAVFAAEQQLAKGTMWHKQCFSCNVCKRPLDSVLACDGPDKEIYCKACYGK 256
G+GCPRCGG VFAAEQQLAKGTMWHK+CF+C C RPLDS+LACDGPDKEI+C+ACYGK
Sbjct: 387 AGQGCPRCGGMVFAAEQQLAKGTMWHKKCFNCAECHRPLDSMLACDGPDKEIHCRACYGK 446
Query: 257 NFGPKGFGYGHSPTLVSTSGE 277
FGPKGFG+GH PTLVST+G+
Sbjct: 447 LFGPKGFGFGHKPTLVSTNGD 467
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|160333386|ref|NP_001103762.1| muscle LIM protein isoform 1 [Bombyx mori] gi|87248175|gb|ABD36140.1| muscle LIM protein [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|242019568|ref|XP_002430232.1| muscle lim protein, putative [Pediculus humanus corporis] gi|212515332|gb|EEB17494.1| muscle lim protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|357619549|gb|EHJ72075.1| muscle LIM protein isoform 1 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307205016|gb|EFN83539.1| Muscle LIM protein Mlp84B [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332373454|gb|AEE61868.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|322797391|gb|EFZ19503.1| hypothetical protein SINV_16490 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332027513|gb|EGI67590.1| Muscle LIM protein Mlp84B [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328788697|ref|XP_394758.3| PREDICTED: muscle LIM protein Mlp84B-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383854456|ref|XP_003702737.1| PREDICTED: muscle LIM protein Mlp84B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 281 | ||||||
| FB|FBgn0014863 | 495 | Mlp84B "Muscle LIM protein at | 0.743 | 0.422 | 0.766 | 2e-95 | |
| UNIPROTKB|F1NMV9 | 194 | CSRP1 "Cysteine and glycine-ri | 0.601 | 0.871 | 0.486 | 2.2e-43 | |
| UNIPROTKB|P67966 | 192 | CSRP1 "Cysteine and glycine-ri | 0.601 | 0.880 | 0.486 | 2.2e-43 | |
| UNIPROTKB|Q3MHY1 | 193 | CSRP1 "Cysteine and glycine-ri | 0.601 | 0.875 | 0.483 | 7.3e-43 | |
| MGI|MGI:88549 | 193 | Csrp1 "cysteine and glycine-ri | 0.601 | 0.875 | 0.477 | 1.2e-42 | |
| UNIPROTKB|F1RYJ8 | 193 | CSRP2 "Uncharacterized protein | 0.604 | 0.880 | 0.463 | 1.2e-42 | |
| UNIPROTKB|P21291 | 193 | CSRP1 "Cysteine and glycine-ri | 0.601 | 0.875 | 0.477 | 1.5e-42 | |
| UNIPROTKB|I3LL97 | 193 | CSRP1 "Uncharacterized protein | 0.601 | 0.875 | 0.477 | 2.5e-42 | |
| UNIPROTKB|J9NYN2 | 193 | CSRP1 "Uncharacterized protein | 0.601 | 0.875 | 0.477 | 3.2e-42 | |
| RGD|62053 | 193 | Csrp1 "cysteine and glycine-ri | 0.601 | 0.875 | 0.472 | 5.2e-42 |
| FB|FBgn0014863 Mlp84B "Muscle LIM protein at 84B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 949 (339.1 bits), Expect = 2.0e-95, P = 2.0e-95
Identities = 161/210 (76%), Positives = 187/210 (89%)
Query: 73 FCRENNAPRT-TVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKT 131
+ ++ AP+ ID KI+A PG+GCPRCGGVV+AAEQ L+KG EWH+KCF C+DC+KT
Sbjct: 196 YAHDDGAPQIRAAIDVDKIQARPGEGCPRCGGVVYAAEQKLSKGREWHKKCFNCKDCHKT 255
Query: 132 LDSINACDGPDKDIYCKTCYGKKWGPHGYGFAAGSGFLQTDGLTEDEISANRPFYNPNTT 191
LDSINA DGPD+D+YC+TCYGKKWGPHGYGFA GSGFLQTDGLTED+ISANRPFYNP+TT
Sbjct: 256 LDSINASDGPDRDVYCRTCYGKKWGPHGYGFACGSGFLQTDGLTEDQISANRPFYNPDTT 315
Query: 192 SIMARKGEGCPRCGGAVFAAEQQLAKGTMWHKQCFSCNVCKRPLDSVLACDGPDKEIYCK 251
SI AR GEGCPRCGGAVFAAEQQL+KG +WHK+C++C C RPLDSVLACDGPD +I+C+
Sbjct: 316 SIKARDGEGCPRCGGAVFAAEQQLSKGKVWHKKCYNCADCHRPLDSVLACDGPDGDIHCR 375
Query: 252 ACYGKNFGPKGFGYGHSPTLVSTSGESTMQ 281
ACYGK FGPKGFGYGH+PTLVSTSGEST+Q
Sbjct: 376 ACYGKLFGPKGFGYGHAPTLVSTSGESTIQ 405
|
|
| UNIPROTKB|F1NMV9 CSRP1 "Cysteine and glycine-rich protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67966 CSRP1 "Cysteine and glycine-rich protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3MHY1 CSRP1 "Cysteine and glycine-rich protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88549 Csrp1 "cysteine and glycine-rich protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RYJ8 CSRP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21291 CSRP1 "Cysteine and glycine-rich protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LL97 CSRP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NYN2 CSRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|62053 Csrp1 "cysteine and glycine-rich protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 281 | |||
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 2e-22 | |
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 3e-20 | |
| cd09404 | 54 | cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 | 6e-16 | |
| cd09404 | 54 | cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 | 8e-14 | |
| cd09403 | 54 | cd09403, LIM2_CRP, The second LIM domain of Cystei | 1e-13 | |
| cd09482 | 54 | cd09482, LIM2_CRP3, The second LIM domain of Cyste | 3e-13 | |
| cd09403 | 54 | cd09403, LIM2_CRP, The second LIM domain of Cystei | 2e-12 | |
| cd09482 | 54 | cd09482, LIM2_CRP3, The second LIM domain of Cyste | 2e-12 | |
| cd09840 | 54 | cd09840, LIM2_CRP2, The second LIM domain of Cyste | 1e-11 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 2e-11 | |
| cd09840 | 54 | cd09840, LIM2_CRP2, The second LIM domain of Cyste | 5e-11 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 6e-10 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 2e-09 | |
| cd09445 | 53 | cd09445, LIM_Mical_like_2, This domain belongs to | 4e-09 | |
| cd09480 | 55 | cd09480, LIM1_CRP2, The first LIM domain of Cystei | 9e-09 | |
| cd09480 | 55 | cd09480, LIM1_CRP2, The first LIM domain of Cystei | 1e-08 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 1e-08 | |
| cd09478 | 54 | cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich | 1e-08 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 3e-08 | |
| cd09402 | 53 | cd09402, LIM1_CRP, The first LIM domain of Cystein | 3e-08 | |
| cd09479 | 56 | cd09479, LIM1_CRP1, The first LIM domain of Cystei | 3e-08 | |
| cd09402 | 53 | cd09402, LIM1_CRP, The first LIM domain of Cystein | 4e-08 | |
| cd09479 | 56 | cd09479, LIM1_CRP1, The first LIM domain of Cystei | 4e-08 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 4e-08 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 9e-08 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 1e-07 | |
| cd09400 | 61 | cd09400, LIM_like_1, LIM domain in proteins of unk | 1e-07 | |
| cd09443 | 55 | cd09443, LIM_Ltd-1, The LIM domain of LIM and tran | 1e-07 | |
| cd09477 | 54 | cd09477, LIM2_TLP, The second LIM domain of thymus | 2e-07 | |
| cd09481 | 54 | cd09481, LIM1_CRP3, The first LIM domain of Cystei | 2e-07 | |
| cd09481 | 54 | cd09481, LIM1_CRP3, The first LIM domain of Cystei | 2e-07 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 3e-07 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 4e-07 | |
| cd09476 | 54 | cd09476, LIM1_TLP, The first LIM domain of thymus | 8e-07 | |
| cd09470 | 54 | cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | 1e-06 | |
| cd09359 | 53 | cd09359, LIM_LASP_like, The LIM domain of LIM and | 2e-06 | |
| cd09447 | 53 | cd09447, LIM_LASP, The LIM domain of LIM and SH3 P | 2e-06 | |
| cd09359 | 53 | cd09359, LIM_LASP_like, The LIM domain of LIM and | 3e-06 | |
| cd09469 | 64 | cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | 5e-06 | |
| cd09369 | 54 | cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L | 7e-06 | |
| cd09470 | 54 | cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | 8e-06 | |
| cd09469 | 64 | cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | 9e-06 | |
| cd09445 | 53 | cd09445, LIM_Mical_like_2, This domain belongs to | 1e-05 | |
| cd09443 | 55 | cd09443, LIM_Ltd-1, The LIM domain of LIM and tran | 1e-05 | |
| cd09369 | 54 | cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L | 1e-05 | |
| cd09440 | 63 | cd09440, LIM1_SF3, The first Lim domain of pollen | 4e-05 | |
| cd09447 | 53 | cd09447, LIM_LASP, The LIM domain of LIM and SH3 P | 6e-05 | |
| cd09381 | 56 | cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of L | 8e-05 | |
| cd09424 | 58 | cd09424, LIM2_FHL1, The second LIM domain of Four | 8e-05 | |
| cd09446 | 53 | cd09446, LIM_N_RAP, The LIM domain of N-RAP | 8e-05 | |
| cd09475 | 59 | cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | 1e-04 | |
| cd09477 | 54 | cd09477, LIM2_TLP, The second LIM domain of thymus | 2e-04 | |
| cd09345 | 54 | cd09345, LIM2_FHL, The second LIM domain of Four a | 2e-04 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 2e-04 | |
| cd09424 | 58 | cd09424, LIM2_FHL1, The second LIM domain of Four | 3e-04 | |
| cd09446 | 53 | cd09446, LIM_N_RAP, The LIM domain of N-RAP | 3e-04 | |
| cd09354 | 60 | cd09354, LIM2_LPP, The second LIM domain of lipoma | 3e-04 | |
| cd09393 | 56 | cd09393, LIM3_Lrg1p_like, The third LIM domain of | 3e-04 | |
| cd09373 | 54 | cd09373, LIM1_AWH, The first LIM domain of Arrowhe | 3e-04 | |
| cd09427 | 58 | cd09427, LIM2_FHL3, The second LIM domain of Four | 4e-04 | |
| cd09478 | 54 | cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich | 9e-04 | |
| cd09366 | 55 | cd09366, LIM1_Isl, The first LIM domain of Isl, a | 9e-04 | |
| cd09345 | 54 | cd09345, LIM2_FHL, The second LIM domain of Four a | 0.001 | |
| cd09444 | 55 | cd09444, LIM_Mical_like_1, This domain belongs to | 0.001 | |
| cd09430 | 52 | cd09430, LIM5_LIMPETin, The fifth LIM domain of pr | 0.001 | |
| cd09370 | 52 | cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | 0.001 | |
| cd09354 | 60 | cd09354, LIM2_LPP, The second LIM domain of lipoma | 0.002 | |
| cd09373 | 54 | cd09373, LIM1_AWH, The first LIM domain of Arrowhe | 0.002 | |
| cd09416 | 56 | cd09416, LIM2_Testin, The second LIM domain of Tes | 0.002 | |
| cd09380 | 54 | cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | 0.002 | |
| cd09382 | 55 | cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 | 0.002 | |
| cd09440 | 63 | cd09440, LIM1_SF3, The first Lim domain of pollen | 0.003 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 0.003 | |
| cd09391 | 57 | cd09391, LIM1_Lrg1p_like, The first LIM domain of | 0.003 | |
| cd09425 | 54 | cd09425, LIM4_LIMPETin, The fourth LIM domain of p | 0.003 | |
| cd09371 | 53 | cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | 0.003 | |
| cd09340 | 58 | cd09340, LIM1_Testin_like, The first LIM domain of | 0.003 | |
| cd09400 | 61 | cd09400, LIM_like_1, LIM domain in proteins of unk | 0.004 | |
| cd09476 | 54 | cd09476, LIM1_TLP, The first LIM domain of thymus | 0.004 | |
| cd09425 | 54 | cd09425, LIM4_LIMPETin, The fourth LIM domain of p | 0.004 | |
| cd09415 | 59 | cd09415, LIM1_Prickle, The first LIM domain of Pri | 0.004 | |
| cd09474 | 59 | cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 | 0.004 | |
| cd09328 | 56 | cd09328, LIM2_abLIM, The second LIM domain on acti | 0.004 |
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
Score = 87.3 bits (217), Expect = 2e-22
Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
Query: 98 CPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCY 151
CPRCG V+AAE+V+A G WH+ CF C CNK LDS + D +IYCK+CY
Sbjct: 1 CPRCGKSVYAAEEVIAAGKSWHKSCFTCAVCNKRLDSTTLAE-HDGEIYCKSCY 53
|
The LIM domains of Cysteine Rich Protein (CRP) family: Cysteine-rich proteins (CRPs) are characterized by the presence of two LIM domains linked to a short glycine-rich repeats (GRRs). The known CRP family members include CRP1, CRP2, and CRP3/MLP. CRP1, CRP2 and CRP3 share a conserved nuclear targeting signal (K/R-K/R-Y-G-P-K), which supports the fact that these proteins function not only in the cytoplasm but also in the nucleus. CRPs control regulatory pathways during cellular differentiation, and involve in complex transcription control, and the organization as well as the arrangement of the myofibrillar/cytoskeletal network. CRP1, CRP2, and CRP3/MLP are involved in promoting protein assembly along the actin-based cytoskeleton. All LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 53 |
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
| >gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A | Back alignment and domain information |
|---|
| >gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A | Back alignment and domain information |
|---|
| >gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) | Back alignment and domain information |
|---|
| >gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) | Back alignment and domain information |
|---|
| >gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) | Back alignment and domain information |
|---|
| >gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) | Back alignment and domain information |
|---|
| >gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 | Back alignment and domain information |
|---|
| >gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) | Back alignment and domain information |
|---|
| >gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8 | Back alignment and domain information |
|---|
| >gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP | Back alignment and domain information |
|---|
| >gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP | Back alignment and domain information |
|---|
| >gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) | Back alignment and domain information |
|---|
| >gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) | Back alignment and domain information |
|---|
| >gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM domains protein 3 (FHL3) | Back alignment and domain information |
|---|
| >gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) | Back alignment and domain information |
|---|
| >gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188828 cd09444, LIM_Mical_like_1, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | Back alignment and domain information |
|---|
| >gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) | Back alignment and domain information |
|---|
| >gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) | Back alignment and domain information |
|---|
| >gnl|CDD|188800 cd09416, LIM2_Testin, The second LIM domain of Testin | Back alignment and domain information |
|---|
| >gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | Back alignment and domain information |
|---|
| >gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 | Back alignment and domain information |
|---|
| >gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle | Back alignment and domain information |
|---|
| >gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 281 | |||
| KOG1701|consensus | 468 | 99.92 | ||
| KOG2272|consensus | 332 | 99.83 | ||
| KOG4577|consensus | 383 | 99.82 | ||
| KOG1701|consensus | 468 | 99.81 | ||
| KOG2272|consensus | 332 | 99.8 | ||
| KOG1703|consensus | 479 | 99.7 | ||
| KOG1044|consensus | 670 | 99.69 | ||
| KOG1703|consensus | 479 | 99.64 | ||
| KOG1044|consensus | 670 | 99.63 | ||
| KOG1700|consensus | 200 | 99.62 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.36 | |
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.34 | |
| KOG4577|consensus | 383 | 99.16 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.47 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.47 | |
| KOG1700|consensus | 200 | 97.82 | ||
| KOG0490|consensus | 235 | 97.7 | ||
| KOG1702|consensus | 264 | 97.59 | ||
| KOG1702|consensus | 264 | 97.33 | ||
| KOG0490|consensus | 235 | 93.85 | ||
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 86.03 | |
| PF09943 | 101 | DUF2175: Uncharacterized protein conserved in arch | 83.21 |
| >KOG1701|consensus | Back alignment and domain information |
|---|
Probab=99.92 E-value=7.4e-27 Score=210.47 Aligned_cols=141 Identities=29% Similarity=0.608 Sum_probs=122.7
Q ss_pred CCCCCCCcCCCccccccce-eeccCcccccCceeccccCCCCCCCCeeeCCCCcccCccchhhccCCCCCCcccCCcccc
Q psy16551 92 AAPGKGCPRCGGVVFAAEQ-VLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKWGPHGYGFAAGSGFLQ 170 (281)
Q Consensus 92 ~~~~~~C~~C~~~I~~~~~-~~~~~~~~H~~CF~C~~C~~~L~~~~~~~~~~g~~~C~~cy~~~~~~~~~~~~c~~~~~~ 170 (281)
..+..+|++|+|.|+..+- +.|+++.||..||+|..|++.|.+..|+. .|+++||+.||....
T Consensus 271 ~~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~-v~~k~~CE~cyq~tl--------------- 334 (468)
T KOG1701|consen 271 EDYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQ-VDGKPYCEGCYQDTL--------------- 334 (468)
T ss_pred hhhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccc-cCCcccchHHHHHHH---------------
Confidence 3344699999999976443 68999999999999999999999988875 999999999998643
Q ss_pred cCCCccccccCCCCCcCCCCccccCCCCCCCCCCCCcccccceeeecCcccccccccccccCCCCCCCccccCCCCcccC
Q psy16551 171 TDGLTEDEISANRPFYNPNTTSIMARKGEGCPRCGGAVFAAEQQLAKGTMWHKQCFSCNVCKRPLDSVLACDGPDKEIYC 250 (281)
Q Consensus 171 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~I~~~~~v~~~g~~~H~~Cf~C~~C~~~L~~~~~~~~~~g~~~C 250 (281)
.+|..|+++|++. ++.+.|+.||+.||+|..|++.|++..|....++++||
T Consensus 335 ----------------------------ekC~~Cg~~I~d~-iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~C 385 (468)
T KOG1701|consen 335 ----------------------------EKCNKCGEPIMDR-ILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYC 385 (468)
T ss_pred ----------------------------HHHhhhhhHHHHH-HHHhcccccCCCceEEEEeccccCCccccccCCCceee
Confidence 3899999999543 56699999999999999999999999999999999999
Q ss_pred hhhhccccCCCCCcCCCCCcccccCCCCC
Q psy16551 251 KACYGKNFGPKGFGYGHSPTLVSTSGEST 279 (281)
Q Consensus 251 ~~c~~~~f~~~c~~c~~~~~~~s~~~~~~ 279 (281)
..||+++|+++|+.|+. +|++ .+|+.|
T Consensus 386 v~dfh~kfAPrCs~C~~-PI~P-~~G~~e 412 (468)
T KOG1701|consen 386 VPDFHKKFAPRCSVCGN-PILP-RDGKDE 412 (468)
T ss_pred ehhhhhhcCcchhhccC-CccC-CCCCcc
Confidence 99999999999999987 5555 566553
|
|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 281 | ||||
| 1b8t_A | 192 | Solution Structure Of The Chicken Crp1 Length = 192 | 2e-28 | ||
| 1qli_A | 113 | Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi | 5e-19 | ||
| 1cxx_A | 113 | Mutant R122a Of Quail Cysteine And Glycine-Rich Pro | 3e-18 | ||
| 1ctl_A | 85 | Structure Of The Carboxy-Terminal Lim Domain From T | 6e-15 | ||
| 1a7i_A | 81 | Amino-Terminal Lim Domain From Quail Cysteine And G | 6e-13 | ||
| 1a7i_A | 81 | Amino-Terminal Lim Domain From Quail Cysteine And G | 8e-12 | ||
| 2o13_A | 58 | Solution Structure Of The C-Terminal Lim Domain Of | 2e-11 | ||
| 1iml_A | 76 | Cysteine Rich Intestinal Protein, Nmr, 48 Structure | 2e-07 | ||
| 1iml_A | 76 | Cysteine Rich Intestinal Protein, Nmr, 48 Structure | 7e-06 | ||
| 2o10_A | 60 | Solution Structure Of The N-Terminal Lim Domain Of | 6e-07 | ||
| 2o10_A | 60 | Solution Structure Of The N-Terminal Lim Domain Of | 2e-06 | ||
| 2cu8_A | 76 | Solution Structure Of The Lim Domain Of Human Cyste | 5e-05 | ||
| 2dfy_X | 195 | Crystal Structure Of A Cyclized Protein Fusion Of L | 7e-04 |
| >pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 | Back alignment and structure |
|
| >pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 | Back alignment and structure |
| >pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 | Back alignment and structure |
| >pdb|1CTL|A Chain A, Structure Of The Carboxy-Terminal Lim Domain From The Cysteine Rich Protein Crp Length = 85 | Back alignment and structure |
| >pdb|1A7I|A Chain A, Amino-Terminal Lim Domain From Quail Cysteine And Glycine- Rich Protein, Nmr, Minimized Average Structure Length = 81 | Back alignment and structure |
| >pdb|1A7I|A Chain A, Amino-Terminal Lim Domain From Quail Cysteine And Glycine- Rich Protein, Nmr, Minimized Average Structure Length = 81 | Back alignment and structure |
| >pdb|2O13|A Chain A, Solution Structure Of The C-Terminal Lim Domain Of MlpCRP3 Length = 58 | Back alignment and structure |
| >pdb|1IML|A Chain A, Cysteine Rich Intestinal Protein, Nmr, 48 Structures Length = 76 | Back alignment and structure |
| >pdb|1IML|A Chain A, Cysteine Rich Intestinal Protein, Nmr, 48 Structures Length = 76 | Back alignment and structure |
| >pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 | Back alignment and structure |
| >pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 | Back alignment and structure |
| >pdb|2CU8|A Chain A, Solution Structure Of The Lim Domain Of Human Cysteine-Rich Protein 2 Length = 76 | Back alignment and structure |
| >pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 281 | |||
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 2e-41 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 4e-18 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 1e-21 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 6e-20 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 1e-20 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 3e-20 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 6e-19 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 7e-19 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 2e-16 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 7e-07 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 3e-16 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 1e-15 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 3e-15 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-15 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-06 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 5e-15 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 2e-13 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 9e-14 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 3e-09 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-13 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-07 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 1e-05 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 5e-13 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 3e-12 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 6e-13 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 3e-12 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 1e-12 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 6e-11 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 1e-11 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 1e-10 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 1e-11 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 6e-09 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 2e-11 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 8e-11 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 3e-11 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 6e-10 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 2e-10 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 3e-09 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 3e-10 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 4e-09 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 1e-09 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 5e-08 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 3e-09 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 1e-08 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 5e-09 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 2e-08 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 1e-08 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 5e-08 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 2e-08 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 7e-08 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 5e-08 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 1e-07 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 6e-08 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 2e-07 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 8e-08 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 1e-07 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 8e-08 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 3e-07 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 2e-07 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 1e-06 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 2e-07 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 7e-07 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 3e-07 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 2e-06 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 4e-07 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 5e-06 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 4e-07 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 5e-07 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 1e-06 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 5e-06 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 1e-06 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 1e-05 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 2e-06 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 1e-05 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 5e-06 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 4e-05 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 7e-06 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 2e-05 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 2e-05 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 2e-05 |
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
Score = 140 bits (353), Expect = 2e-41
Identities = 80/183 (43%), Positives = 97/183 (53%), Gaps = 8/183 (4%)
Query: 91 KAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTC 150
GK C C V+ AE+V +GS +H+ CF C C K LDS D+ IYCK+C
Sbjct: 3 NWGGGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDE-IYCKSC 61
Query: 151 YGKKWGPHGYGFAAGSGFLQTDGLTEDEISANRPFYNPNTTS------IMARKGEGCPRC 204
YGKK+GP G G G+G L TD I + T +GCPRC
Sbjct: 62 YGKKYGPKGKGKGMGAGTLSTDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRC 121
Query: 205 GGAVFAAEQQLAKGTMWHKQCFSCNVCKRPLDSVLACDGPDKEIYCKACYGKNFGPKGFG 264
G AV+AAE+ + G WHK CF C C + L+S D D EIYCK CY KNFGPKGFG
Sbjct: 122 GQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLAD-KDGEIYCKGCYAKNFGPKGFG 180
Query: 265 YGH 267
+G
Sbjct: 181 FGQ 183
|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 281 | |||
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.96 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.94 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.94 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.93 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.93 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.92 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.88 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.8 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.75 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.75 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.75 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.74 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.74 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.72 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.72 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.66 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.65 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.63 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.6 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.6 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.59 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.59 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.58 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.58 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.57 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.57 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.55 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.55 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.55 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.55 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.54 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.54 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.54 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.54 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.54 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.54 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.53 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.53 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.53 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.53 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.52 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.52 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.52 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.52 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.52 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.51 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.51 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.51 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.51 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.51 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.51 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.51 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.5 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.5 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.49 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.49 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.49 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.48 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.48 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.48 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.47 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.47 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.46 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.46 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.45 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.44 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.43 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.43 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.42 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.42 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.41 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.41 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.41 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.41 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.41 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.4 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.4 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.39 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.39 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.36 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.34 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.34 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.3 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.27 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.21 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.07 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 88.5 |
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
Probab=99.96 E-value=1.7e-30 Score=219.33 Aligned_cols=175 Identities=47% Similarity=0.975 Sum_probs=134.0
Q ss_pred CCCCcCCCccccccceeeccCcccccCceeccccCCCCCCCCeeeCCCCcccCccchhhccCCCCCCcccCCcccccCCC
Q psy16551 95 GKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKWGPHGYGFAAGSGFLQTDGL 174 (281)
Q Consensus 95 ~~~C~~C~~~I~~~~~~~~~~~~~H~~CF~C~~C~~~L~~~~~~~~~~g~~~C~~cy~~~~~~~~~~~~c~~~~~~~~~~ 174 (281)
.+.|.+|+++|+.++.+.++++.||++||+|..|+++|....++ .++|++||+.||.++|++++++.+-..+.+..|..
T Consensus 7 ~~~C~~C~~~I~~~~~v~a~g~~wH~~CF~C~~C~~~L~~~~~~-~~~g~~yC~~cy~~~f~~~c~~c~~~~g~~~~~~~ 85 (192)
T 1b8t_A 7 GKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVA-VHGDEIYCKSCYGKKYGPKGKGKGMGAGTLSTDKG 85 (192)
T ss_dssp CEECTTTCCEECSSCCEEETTEEECTTTCBCTTTCCBCCSSSEE-EETTEEEEHHHHHHHHSCCCCCCCCCCCCCCCCCC
T ss_pred CCcCccCCCeecceeEEEeCCceecCCCCcCcccCCcCCCCeeE-ecCCEeeChhhhHhhcCccccccccccccEecCCC
Confidence 46799999999888899999999999999999999999987766 49999999999999999987654322333322221
Q ss_pred c-----cccccCCCCCcCCCCc--cccCCCCCCCCCCCCcccccceeeecCcccccccccccccCCCCCCCccccCCCCc
Q psy16551 175 T-----EDEISANRPFYNPNTT--SIMARKGEGCPRCGGAVFAAEQQLAKGTMWHKQCFSCNVCKRPLDSVLACDGPDKE 247 (281)
Q Consensus 175 ~-----~~~~~~~~~~~~~~~~--~~~~~~~~~C~~C~~~I~~~~~v~~~g~~~H~~Cf~C~~C~~~L~~~~~~~~~~g~ 247 (281)
. ........| .....+ .-..++..+|++|+++|..++.+.++++.||++||+|..|+++|....++ ..+|+
T Consensus 86 ~~~~~~~~~~~~~~p-~~~~~~~~~~~~~~~~~C~~C~~~I~~~~~v~a~~~~~H~~CF~C~~C~~~L~~~~~~-~~~g~ 163 (192)
T 1b8t_A 86 ESLGIKYEEGQSHRP-TNPNASRMAQKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLA-DKDGE 163 (192)
T ss_dssp CCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCEECTTTSCEECSSSCEEETTEEECTTTCBCTTTCCBCCSSSEE-EETTE
T ss_pred cccccccccccccCC-CCcCccccccccCCCCcCCCCCCEecCcEEEecCCCccchhcCCccccCCCCCCCccc-ccCCE
Confidence 0 000111111 000000 01113455799999999888888899999999999999999999776664 79999
Q ss_pred ccChhhhccccCCCCCcCCCCCccc
Q psy16551 248 IYCKACYGKNFGPKGFGYGHSPTLV 272 (281)
Q Consensus 248 ~~C~~c~~~~f~~~c~~c~~~~~~~ 272 (281)
+||+.||.++|+++|.+|+.+++..
T Consensus 164 ~yC~~cy~~~f~~kc~~C~~~~g~~ 188 (192)
T 1b8t_A 164 IYCKGCYAKNFGPKGFGFGQGAGAL 188 (192)
T ss_dssp EEEHHHHHHHTCCCCCCCCCCCCCC
T ss_pred EeCHHHHHHhcCCcCCCCCCcccce
Confidence 9999999999999999999986433
|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 281 | ||||
| d1b8ta2 | 65 | g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro | 2e-18 | |
| d1b8ta2 | 65 | g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro | 3e-14 | |
| d1b8ta4 | 49 | g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr | 1e-15 | |
| d1b8ta4 | 49 | g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr | 3e-13 | |
| d1b8ta3 | 43 | g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr | 6e-09 | |
| d1b8ta3 | 43 | g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr | 2e-07 | |
| d1imla2 | 48 | g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot | 2e-08 | |
| d1imla2 | 48 | g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot | 5e-08 | |
| d1ibia1 | 28 | g.39.1.3 (A:117-144) Cysteine-rich (intestinal) pr | 7e-06 | |
| d1ibia1 | 28 | g.39.1.3 (A:117-144) Cysteine-rich (intestinal) pr | 9e-06 | |
| d1a7ia2 | 32 | g.39.1.3 (A:36-67) Cysteine-rich (intestinal) prot | 5e-05 | |
| d1a7ia2 | 32 | g.39.1.3 (A:36-67) Cysteine-rich (intestinal) prot | 1e-04 | |
| d2cu8a1 | 30 | g.39.1.3 (A:8-37) Cysteine-rich (intestinal) prote | 5e-05 | |
| d2cu8a1 | 30 | g.39.1.3 (A:8-37) Cysteine-rich (intestinal) prote | 4e-04 | |
| d2d8ya1 | 35 | g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien | 5e-05 | |
| d2d8ya1 | 35 | g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien | 7e-04 | |
| d1ibia2 | 31 | g.39.1.3 (A:145-175) Cysteine-rich (intestinal) pr | 0.002 | |
| d1ibia2 | 31 | g.39.1.3 (A:145-175) Cysteine-rich (intestinal) pr | 0.002 | |
| d2co8a2 | 36 | g.39.1.3 (A:8-43) Nedd9 interacting protein with c | 0.003 | |
| d2co8a2 | 36 | g.39.1.3 (A:8-43) Nedd9 interacting protein with c | 0.004 |
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Cysteine-rich (intestinal) protein, CRP, CRIP species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 75.3 bits (185), Expect = 2e-18
Identities = 29/65 (44%), Positives = 37/65 (56%), Gaps = 6/65 (9%)
Query: 125 CRDCNKTLDSINACDGPDKDIYCKTCYGKKWGPHGYGFAAGSGFLQTD-----GLTEDEI 179
C C K LDS D +IYCK+CYGKK+GP G G G+G L TD G+ +E
Sbjct: 2 CMVCKKNLDSTTVAVHGD-EIYCKSCYGKKYGPKGKGKGMGAGTLSTDKGESLGIKYEEG 60
Query: 180 SANRP 184
++RP
Sbjct: 61 QSHRP 65
|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 32 | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 32 | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 31 | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 31 | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 281 | |||
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.83 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.77 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.68 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.62 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.47 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.45 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.44 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.41 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.35 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.33 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.33 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.24 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.23 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.22 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.22 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.22 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.22 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.19 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.17 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.07 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.06 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.06 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.03 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.0 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.0 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.99 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.98 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.96 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.94 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.91 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.9 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.87 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 97.85 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.84 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.83 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.83 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.83 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.82 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.8 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.77 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 97.77 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.71 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 97.69 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.68 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.68 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.65 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.65 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 97.64 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.64 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.63 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 97.58 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.57 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.55 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.53 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.48 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.48 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.46 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.45 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.45 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.44 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 97.42 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.36 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.34 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 97.31 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.28 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.28 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.27 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.26 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.25 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.24 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.21 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 97.2 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.19 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.19 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.11 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.09 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.09 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.04 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.01 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.77 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.62 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 96.56 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.47 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 96.46 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.46 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.43 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.36 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.31 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.29 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.21 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 96.19 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 96.05 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 95.98 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.97 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.92 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.62 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.62 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 95.27 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.26 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 95.12 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.11 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.06 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 94.77 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 94.43 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 94.36 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 94.16 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 94.15 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 94.09 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 93.89 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 92.44 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 92.19 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 91.64 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 91.61 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 91.15 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 90.22 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 90.16 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 89.96 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 89.6 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 89.0 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 88.63 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 88.59 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 87.62 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 87.6 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 85.42 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 83.99 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 82.94 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 82.33 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 81.29 |
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Leupaxin species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.86 E-value=4e-10 Score=65.81 Aligned_cols=26 Identities=35% Similarity=0.791 Sum_probs=24.2
Q ss_pred CCCCCCCcccccceeeecCcccccccc
Q psy16551 200 GCPRCGGAVFAAEQQLAKGTMWHKQCF 226 (281)
Q Consensus 200 ~C~~C~~~I~~~~~v~~~g~~~H~~Cf 226 (281)
+|..|+++| .++.|.|+|+.||++||
T Consensus 10 kC~~C~~~I-~g~~v~Al~~~wHpeCF 35 (35)
T d1x3ha1 10 KCGGCNRPV-LENYLSAMDTVWHPECF 35 (35)
T ss_dssp BCTTTCCBC-CSSCEEETTEEECTTTC
T ss_pred hhhhcCCcc-cchheeecCCccCcccC
Confidence 999999999 57788999999999998
|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|