Diaphorina citri psyllid: psy16556


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI
cEEECccccccccccEEEEccccEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccccccccc
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sorbitol dehydrogenase Converts sorbitol to fructose. Part of the polyol pathway that plays an important role in sperm physiology. May play a role in the sperm motility by providing an energetic source for sperm.confidentQ58D31
Sorbitol dehydrogenase Converts sorbitol to fructose. Part of the polyol pathway that plays an important role in sperm physiology. May play a role in the sperm motility by providing an energetic source for sperm.confidentQ64442
Probable D-xylulose reductase A Xylitol dehydrogenase which catalyzes the conversion of xylitol to D-xylulose. Xylose is a major component of hemicelluloses such as xylan. Most fungi utilize D-xylose via three enzymatic reactions, xylose reductase (XR), xylitol dehydrogenase (XDH), and xylulokinase, to form xylulose 5-phosphate, which enters pentose phosphate pathway.confidentA2QY54

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051287 [MF]NAD bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0051160 [BP]L-xylitol catabolic processprobableGO:0046174, GO:0019751, GO:0051164, GO:0044281, GO:0044282, GO:0019527, GO:1901575, GO:0044262, GO:0071704, GO:0019405, GO:0019400, GO:0044712, GO:0009987, GO:0046164, GO:0044710, GO:0008150, GO:0008152, GO:0044723, GO:0009056, GO:0044724, GO:0044275, GO:0044238, GO:0005975, GO:0019519, GO:0016052, GO:0044237, GO:0006066, GO:1901616, GO:1901615
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0016020 [CC]membraneprobableGO:0005575
GO:0050019 [MF]L-arabinitol 4-dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003939 [MF]L-iditol 2-dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0030446 [CC]hyphal cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0046526 [MF]D-xylulose reductase activityprobableGO:0016614, GO:0016616, GO:0031320, GO:0003824, GO:0003674, GO:0016491
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0046370 [BP]fructose biosynthetic processprobableGO:1901576, GO:0005975, GO:0044238, GO:0005996, GO:0019318, GO:0019319, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0046364, GO:0044723, GO:0006000
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046688 [BP]response to copper ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0046686 [BP]response to cadmium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0030317 [BP]sperm motilityprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0006062 [BP]sorbitol catabolic processprobableGO:0046174, GO:0019751, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0044262, GO:0006059, GO:0071704, GO:0019405, GO:0019407, GO:0019400, GO:0009987, GO:0046164, GO:0044710, GO:0008150, GO:0008152, GO:0044723, GO:0009056, GO:0044724, GO:0044275, GO:0044238, GO:0005975, GO:0016052, GO:0044237, GO:0006066, GO:0006060, GO:1901616, GO:1901615

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1E3J, chain A
Confidence level:very confident
Coverage over the Query: 9-100
View the alignment between query and template
View the model in PyMOL