Psyllid ID: psy16556


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI
cEEEEccccccccccEEEEccccEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccccccccc
cEEccEccEccccEcEEEEEHHHEEEccccccHHHHHcHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHcc
mvfcatpphhgnlsqFYKHAADFcyklpdhltleegalleplavgvhackrsgvglGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYvgirifpykki
mvfcatpphhgNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGirifpykki
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI
********HHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPY***
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query100 2.2.26 [Sep-21-2011]
Q58D31 356 Sorbitol dehydrogenase OS yes N/A 0.98 0.275 0.612 9e-30
P07846 354 Sorbitol dehydrogenase OS N/A N/A 0.98 0.276 0.612 1e-29
Q00796 357 Sorbitol dehydrogenase OS yes N/A 0.98 0.274 0.612 1e-28
Q5R5F3 357 Sorbitol dehydrogenase OS yes N/A 0.98 0.274 0.602 2e-28
P27867 357 Sorbitol dehydrogenase OS yes N/A 0.98 0.274 0.591 2e-28
Q64442 357 Sorbitol dehydrogenase OS yes N/A 0.98 0.274 0.581 3e-28
Q4R639 357 Sorbitol dehydrogenase OS N/A N/A 1.0 0.280 0.59 8e-28
Q1PSI9 366 L-idonate 5-dehydrogenase no N/A 0.86 0.234 0.528 2e-22
Q02912 348 Sorbitol dehydrogenase OS N/A N/A 0.92 0.264 0.478 3e-21
Q5GN51 358 D-xylulose reductase A OS yes N/A 0.86 0.240 0.540 2e-20
>sp|Q58D31|DHSO_BOVIN Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3 Back     alignment and function desciption
 Score =  128 bits (322), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (76%)

Query: 3   FCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLV 62
           FCATPP  GNL +FYKH A+FCYKLPD++T EEGAL+EPL+VG+HAC+R+GV LG  VLV
Sbjct: 118 FCATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLV 177

Query: 63  LSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI 100
             AGPIGLV++LAAKA GA  + V      R+   K++
Sbjct: 178 CGAGPIGLVSLLAAKAMGAAQVVVTDLSASRLSKAKEV 215




Converts sorbitol to fructose. Part of the polyol pathway that plays an important role in sperm physiology. May play a role in the sperm motility by providing an energetic source for sperm.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 4
>sp|P07846|DHSO_SHEEP Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1 Back     alignment and function description
>sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=4 Back     alignment and function description
>sp|Q5R5F3|DHSO_PONAB Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1 Back     alignment and function description
>sp|P27867|DHSO_RAT Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sord PE=1 SV=4 Back     alignment and function description
>sp|Q64442|DHSO_MOUSE Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=1 SV=3 Back     alignment and function description
>sp|Q4R639|DHSO_MACFA Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 Back     alignment and function description
>sp|Q1PSI9|IDND_VITVI L-idonate 5-dehydrogenase OS=Vitis vinifera GN=VIT_16s0100g00290 PE=1 SV=2 Back     alignment and function description
>sp|Q02912|DHSO_BOMMO Sorbitol dehydrogenase OS=Bombyx mori GN=SDH PE=2 SV=1 Back     alignment and function description
>sp|Q5GN51|XYL2_ASPNG D-xylulose reductase A OS=Aspergillus niger GN=xdhA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
195110223 638 GI22938 [Drosophila mojavensis] gi|19391 0.94 0.147 0.680 1e-33
312285788 227 hypothetical protein [Bactrocera oleae] 1.0 0.440 0.67 2e-33
195499907 360 GE26061 [Drosophila yakuba] gi|194183248 1.0 0.277 0.66 4e-33
194902172 360 GG17814 [Drosophila erecta] gi|190652326 1.0 0.277 0.66 4e-33
17737897 360 sorbitol dehydrogenase-2 [Drosophila mel 1.0 0.277 0.66 4e-33
195329989 360 GM23911 [Drosophila sechellia] gi|194120 1.0 0.277 0.66 4e-33
195452032 363 GK13991 [Drosophila willistoni] gi|19416 1.0 0.275 0.65 1e-32
195571879 360 GD18723 [Drosophila simulans] gi|1941998 1.0 0.277 0.65 2e-32
307204829 350 Sorbitol dehydrogenase [Harpegnathos sal 1.0 0.285 0.66 4e-32
332021414 350 Sorbitol dehydrogenase [Acromyrmex echin 1.0 0.285 0.66 6e-32
>gi|195110223|ref|XP_001999681.1| GI22938 [Drosophila mojavensis] gi|193916275|gb|EDW15142.1| GI22938 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/94 (68%), Positives = 80/94 (85%)

Query: 1   MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSV 60
           MVFCATPP+ GNL+++YKHAADFC+KLPDH+T+EEGALLEPL+VGVHACKR+GV LG+ V
Sbjct: 391 MVFCATPPYDGNLTRYYKHAADFCFKLPDHVTMEEGALLEPLSVGVHACKRAGVSLGSRV 450

Query: 61  LVLSAGPIGLVTILAAKAYGARVICVCKYVGIRI 94
           L+L AGPIGLVT+L A++ GA  I +   V  R+
Sbjct: 451 LILGAGPIGLVTLLVAQSMGATEILITDLVQHRL 484




Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312285788|gb|ADQ64584.1| hypothetical protein [Bactrocera oleae] Back     alignment and taxonomy information
>gi|195499907|ref|XP_002097147.1| GE26061 [Drosophila yakuba] gi|194183248|gb|EDW96859.1| GE26061 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194902172|ref|XP_001980623.1| GG17814 [Drosophila erecta] gi|190652326|gb|EDV49581.1| GG17814 [Drosophila erecta] Back     alignment and taxonomy information
>gi|17737897|ref|NP_524311.1| sorbitol dehydrogenase-2 [Drosophila melanogaster] gi|4100630|gb|AAD00903.1| sorbitol dehydrogenase [Drosophila melanogaster] gi|7299382|gb|AAF54573.1| sorbitol dehydrogenase-2 [Drosophila melanogaster] gi|16198265|gb|AAL13960.1| LD47736p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195329989|ref|XP_002031691.1| GM23911 [Drosophila sechellia] gi|194120634|gb|EDW42677.1| GM23911 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195452032|ref|XP_002073183.1| GK13991 [Drosophila willistoni] gi|194169268|gb|EDW84169.1| GK13991 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195571879|ref|XP_002103928.1| GD18723 [Drosophila simulans] gi|194199855|gb|EDX13431.1| GD18723 [Drosophila simulans] Back     alignment and taxonomy information
>gi|307204829|gb|EFN83387.1| Sorbitol dehydrogenase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332021414|gb|EGI61782.1| Sorbitol dehydrogenase [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
FB|FBgn0022359 360 Sodh-2 "Sorbitol dehydrogenase 1.0 0.277 0.66 5.2e-33
FB|FBgn0024289 360 Sodh-1 "Sorbitol dehydrogenase 1.0 0.277 0.65 7.7e-32
UNIPROTKB|F1PXG0 356 SORD "Uncharacterized protein" 0.98 0.275 0.612 2.7e-29
UNIPROTKB|Q58D31 356 SORD "Sorbitol dehydrogenase" 0.98 0.275 0.612 7.1e-29
UNIPROTKB|P07846 354 SORD "Sorbitol dehydrogenase" 0.98 0.276 0.612 9.1e-29
ZFIN|ZDB-GENE-040426-1231 354 sord "sorbitol dehydrogenase" 0.98 0.276 0.602 1.2e-28
UNIPROTKB|H0YLA4 336 SORD "Sorbitol dehydrogenase" 0.98 0.291 0.612 3.1e-28
UNIPROTKB|Q00796 357 SORD "Sorbitol dehydrogenase" 0.98 0.274 0.612 3.1e-28
RGD|3734 357 Sord "sorbitol dehydrogenase" 0.98 0.274 0.591 3.9e-28
UNIPROTKB|Q5R5F3 357 SORD "Sorbitol dehydrogenase" 0.98 0.274 0.602 5e-28
FB|FBgn0022359 Sodh-2 "Sorbitol dehydrogenase-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 360 (131.8 bits), Expect = 5.2e-33, P = 5.2e-33
 Identities = 66/100 (66%), Positives = 85/100 (85%)

Query:     1 MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSV 60
             MVFCATPP+ GNL+++YKHAADFC+KLPDH+++EEGALLEPL+VGVHAC+R+GVGLG+ V
Sbjct:   113 MVFCATPPYDGNLTRYYKHAADFCFKLPDHVSMEEGALLEPLSVGVHACRRAGVGLGSKV 172

Query:    61 LVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI 100
             L+L AGPIGLVT+LAA+A GA  I +   V  R+   K++
Sbjct:   173 LILGAGPIGLVTLLAAQAMGASEILITDLVQQRLDVAKEL 212




GO:0003939 "L-iditol 2-dehydrogenase activity" evidence=ISS;TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
FB|FBgn0024289 Sodh-1 "Sorbitol dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXG0 SORD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D31 SORD "Sorbitol dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P07846 SORD "Sorbitol dehydrogenase" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1231 sord "sorbitol dehydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H0YLA4 SORD "Sorbitol dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q00796 SORD "Sorbitol dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|3734 Sord "sorbitol dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R5F3 SORD "Sorbitol dehydrogenase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q64442DHSO_MOUSE1, ., 1, ., 1, ., 1, 40.58160.980.2745yesN/A
A2QY54XYL2_ASPNC1, ., 1, ., 1, ., 90.54020.860.2402yesN/A
P27867DHSO_RAT1, ., 1, ., 1, ., 1, 40.59180.980.2745yesN/A
Q5ARL6XYL2_EMENI1, ., 1, ., 1, ., 90.50570.860.2395yesN/A
Q92MT4XYLD_RHIME1, ., 1, ., 1, ., 90.51280.780.2254yesN/A
Q58D31DHSO_BOVIN1, ., 1, ., 1, ., 1, 40.61220.980.2752yesN/A
Q07786DHSO2_YEAST1, ., 1, ., 1, ., 1, 40.51850.810.2268yesN/A
Q00796DHSO_HUMAN1, ., 1, ., 1, ., 1, 40.61220.980.2745yesN/A
Q5GN51XYL2_ASPNG1, ., 1, ., 1, ., 90.54020.860.2402yesN/A
P35497DHSO1_YEAST1, ., 1, ., 1, ., 1, 40.51850.810.2268yesN/A
Q5R5F3DHSO_PONAB1, ., 1, ., 1, ., 1, 40.60200.980.2745yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
cd05285 343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 2e-48
PLN02702 364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 9e-35
cd08233 351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 2e-24
cd08232 339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 7e-20
cd08236 343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 8e-20
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 2e-19
cd08261 337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 4e-18
cd08234 334 cd08234, threonine_DH_like, L-threonine dehydrogen 1e-16
cd08235 343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 2e-16
cd08262 341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 4e-16
COG1063 350 COG1063, Tdh, Threonine dehydrogenase and related 1e-15
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 5e-13
cd08256 350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 3e-11
cd08255 277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 6e-10
cd08239 339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 9e-10
cd08230 355 cd08230, glucose_DH, Glucose dehydrogenase 9e-10
cd05278 347 cd05278, FDH_like, Formaldehyde dehydrogenases 2e-09
PRK10309 347 PRK10309, PRK10309, galactitol-1-phosphate dehydro 3e-09
PRK09880 343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 2e-08
PRK05396 341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 2e-08
COG1064 339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 1e-07
cd08283 386 cd08283, FDH_like_1, Glutathione-dependent formald 1e-07
cd08259 332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 2e-07
TIGR00692 340 TIGR00692, tdh, L-threonine 3-dehydrogenase 2e-07
cd08284 344 cd08284, FDH_like_2, Glutathione-dependent formald 3e-07
cd05281 341 cd05281, TDH, Threonine dehydrogenase 4e-07
cd08231 361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 4e-07
cd08269 312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 2e-06
cd08241 323 cd08241, QOR1, Quinone oxidoreductase (QOR) 2e-06
cd08285 351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 2e-06
cd08242 319 cd08242, MDR_like, Medium chain dehydrogenases/red 3e-06
cd08265 384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 3e-06
cd08248 350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 3e-06
PRK13771 334 PRK13771, PRK13771, putative alcohol dehydrogenase 8e-06
COG0604 326 COG0604, Qor, NADPH:quinone reductase and related 9e-06
PRK10083 339 PRK10083, PRK10083, putative oxidoreductase; Provi 1e-05
cd08276 336 cd08276, MDR7, Medium chain dehydrogenases/reducta 3e-05
cd05195 293 cd05195, enoyl_red, enoyl reductase of polyketide 8e-05
cd08260 345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 9e-05
cd08264 325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 1e-04
cd08249 339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 2e-04
cd08266 342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 2e-04
cd08282 375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 4e-04
cd08246 393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 6e-04
cd08281 371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 9e-04
cd08254 338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 0.001
cd08287 345 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase 0.001
cd08298 329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 0.002
smart00829 287 smart00829, PKS_ER, Enoylreductase 0.002
cd05279 365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 0.002
TIGR02819 393 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenas 0.002
cd08275 337 cd08275, MDR3, Medium chain dehydrogenases/reducta 0.003
cd05283 337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 0.004
cd08267 319 cd08267, MDR1, Medium chain dehydrogenases/reducta 0.004
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
 Score =  156 bits (397), Expect = 2e-48
 Identities = 52/87 (59%), Positives = 66/87 (75%)

Query: 1   MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSV 60
           M F ATPP  G L ++  H ADFC+KLPD+++LEEGAL+EPL+VGVHAC+R+GV  G +V
Sbjct: 107 MRFAATPPVDGTLCRYVNHPADFCHKLPDNVSLEEGALVEPLSVGVHACRRAGVRPGDTV 166

Query: 61  LVLSAGPIGLVTILAAKAYGARVICVC 87
           LV  AGPIGL+T   AKA+GA  + V 
Sbjct: 167 LVFGAGPIGLLTAAVAKAFGATKVVVT 193


Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 343

>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 100
KOG0024|consensus 354 99.94
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 99.92
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 99.88
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 99.86
TIGR03366 280 HpnZ_proposed putative phosphonate catabolism asso 99.84
cd08237 341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.83
TIGR02818 368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 99.83
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.83
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.82
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.82
PLN02740 381 Alcohol dehydrogenase-like 99.81
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 99.81
KOG0023|consensus 360 99.8
cd08300 368 alcohol_DH_class_III class III alcohol dehydrogena 99.8
cd08301 369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.8
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.79
cd08277 365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.79
PRK10309 347 galactitol-1-phosphate dehydrogenase; Provisional 99.79
PLN02827 378 Alcohol dehydrogenase-like 99.79
KOG1198|consensus 347 99.78
KOG0022|consensus 375 99.77
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.77
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 99.76
cd08233 351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.76
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.76
PLN02586 360 probable cinnamyl alcohol dehydrogenase 99.76
cd08299 373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.75
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.75
PLN02178 375 cinnamyl-alcohol dehydrogenase 99.75
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.74
TIGR02825 325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.74
cd08246 393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.73
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 99.73
cd08231 361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.73
KOG1197|consensus 336 99.72
TIGR02819 393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.72
PLN02514 357 cinnamyl-alcohol dehydrogenase 99.72
cd05279 365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.72
cd08242 319 MDR_like Medium chain dehydrogenases/reductase (MD 99.72
TIGR02817 336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.71
cd08285 351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.71
PRK09422 338 ethanol-active dehydrogenase/acetaldehyde-active r 99.71
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.71
cd08262 341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.71
cd08296 333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.71
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.71
PRK10083 339 putative oxidoreductase; Provisional 99.71
cd05285 343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.7
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.7
cd08278 365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.7
PLN02702 364 L-idonate 5-dehydrogenase 99.7
cd08292 324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.7
cd08291 324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.69
cd08282 375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.69
cd08298 329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.69
cd05284 340 arabinose_DH_like D-arabinose dehydrogenase. This 99.69
cd08238 410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.69
cd08243 320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.68
cd08284 344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.68
PTZ00354 334 alcohol dehydrogenase; Provisional 99.67
cd08256 350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.67
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.67
cd08270 305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.67
TIGR01751 398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.67
cd08236 343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.67
cd08265 384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.66
cd08235 343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.66
cd05278 347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.66
cd08290 341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.66
cd08289 326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.66
cd08263 367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.66
cd08274 350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.66
cd08255 277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.66
cd05283 337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.66
cd08261 337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.66
cd08279 363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.65
cd08232 339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.65
PRK10754 327 quinone oxidoreductase, NADPH-dependent; Provision 99.65
cd08234 334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.65
cd08260 345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.65
PRK13771 334 putative alcohol dehydrogenase; Provisional 99.64
cd08244 324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.64
KOG0025|consensus 354 99.64
smart00829 288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.64
cd05280 325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.64
cd08297 341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.64
cd08288 324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.64
cd08251 303 polyketide_synthase polyketide synthase. Polyketid 99.63
cd08240 350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.63
cd08245 330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.63
cd08254 338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.63
cd08286 345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.63
TIGR02823 323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.63
cd05282 323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.62
cd08259 332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.61
cd05195 293 enoyl_red enoyl reductase of polyketide synthase. 99.61
cd08252 336 AL_MDR Arginate lyase and other MDR family members 99.61
cd08287 345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.6
cd08269 312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.6
cd08276 336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.59
cd05276 323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.59
KOG1202|consensus 2376 99.59
PRK05396 341 tdh L-threonine 3-dehydrogenase; Validated 99.58
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.58
cd08249 339 enoyl_reductase_like enoyl_reductase_like. Member 99.58
TIGR00692 340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.57
cd05286 320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.57
cd05281 341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.57
cd08250 329 Mgc45594_like Mgc45594 gene product and other MDR 99.57
cd08273 331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.57
cd08253 325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.55
TIGR02824 325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.55
cd08248 350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.55
cd08267 319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.55
cd08264 325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.54
cd05288 329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.54
COG2130 340 Putative NADP-dependent oxidoreductases [General f 99.53
cd08268 328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.53
cd08266 342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.52
cd08272 326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.52
cd08241 323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.5
cd08247 352 AST1_like AST1 is a cytoplasmic protein associated 99.49
cd08271 325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.47
cd05289 309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.45
cd08275 337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.36
KOG1196|consensus 343 99.29
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.68
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.55
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.45
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 98.31
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.19
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.19
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.17
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.01
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 98.0
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.97
PRK08306 296 dipicolinate synthase subunit A; Reviewed 97.85
PLN02494 477 adenosylhomocysteinase 97.82
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 97.82
PRK08324 681 short chain dehydrogenase; Validated 97.79
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 97.72
PRK12550 272 shikimate 5-dehydrogenase; Reviewed 97.71
PF01262 168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.65
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.62
PRK12549 284 shikimate 5-dehydrogenase; Reviewed 97.61
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.6
PTZ00075 476 Adenosylhomocysteinase; Provisional 97.58
TIGR01809 282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.54
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.5
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.5
PRK00258 278 aroE shikimate 5-dehydrogenase; Reviewed 97.5
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.48
COG0169 283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.45
PRK14027 283 quinate/shikimate dehydrogenase; Provisional 97.44
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 97.43
PRK05993 277 short chain dehydrogenase; Provisional 97.39
COG0300 265 DltE Short-chain dehydrogenases of various substra 97.37
PRK08017 256 oxidoreductase; Provisional 97.36
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 97.36
PRK06949 258 short chain dehydrogenase; Provisional 97.35
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.33
PRK06057 255 short chain dehydrogenase; Provisional 97.3
PRK05872 296 short chain dehydrogenase; Provisional 97.28
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.28
PRK04148134 hypothetical protein; Provisional 97.28
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 97.26
PRK07814 263 short chain dehydrogenase; Provisional 97.26
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 97.25
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.25
PLN03209 576 translocon at the inner envelope of chloroplast su 97.24
PLN02780 320 ketoreductase/ oxidoreductase 97.24
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.23
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 97.23
PRK08339 263 short chain dehydrogenase; Provisional 97.22
PRK12548 289 shikimate 5-dehydrogenase; Provisional 97.21
PF02737 180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.21
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.2
PRK05866 293 short chain dehydrogenase; Provisional 97.2
PRK07326 237 short chain dehydrogenase; Provisional 97.19
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 97.19
PRK07523 255 gluconate 5-dehydrogenase; Provisional 97.18
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 97.17
PRK07831 262 short chain dehydrogenase; Provisional 97.17
PRK07062 265 short chain dehydrogenase; Provisional 97.17
PRK06139 330 short chain dehydrogenase; Provisional 97.16
PRK12828 239 short chain dehydrogenase; Provisional 97.15
PRK07060 245 short chain dehydrogenase; Provisional 97.15
PRK12829 264 short chain dehydrogenase; Provisional 97.14
PRK08213 259 gluconate 5-dehydrogenase; Provisional 97.14
PRK06180 277 short chain dehydrogenase; Provisional 97.14
PRK05867 253 short chain dehydrogenase; Provisional 97.13
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 97.13
PRK07576 264 short chain dehydrogenase; Provisional 97.13
PRK13940 414 glutamyl-tRNA reductase; Provisional 97.13
TIGR02964 246 xanthine_xdhC xanthine dehydrogenase accessory pro 97.13
PRK07825 273 short chain dehydrogenase; Provisional 97.12
PRK08703 239 short chain dehydrogenase; Provisional 97.11
PRK09072 263 short chain dehydrogenase; Provisional 97.11
PRK09291 257 short chain dehydrogenase; Provisional 97.11
PRK07890 258 short chain dehydrogenase; Provisional 97.11
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.11
PRK06841 255 short chain dehydrogenase; Provisional 97.1
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.09
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.09
PRK00377 198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.08
PRK07063 260 short chain dehydrogenase; Provisional 97.08
PRK07677 252 short chain dehydrogenase; Provisional 97.08
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 97.07
PRK06500 249 short chain dehydrogenase; Provisional 97.06
PRK12939 250 short chain dehydrogenase; Provisional 97.06
PRK07035 252 short chain dehydrogenase; Provisional 97.06
PRK07478 254 short chain dehydrogenase; Provisional 97.06
PRK06194 287 hypothetical protein; Provisional 97.06
PRK06125 259 short chain dehydrogenase; Provisional 97.05
PRK08265 261 short chain dehydrogenase; Provisional 97.04
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 97.04
PRK06182 273 short chain dehydrogenase; Validated 97.03
PRK06172 253 short chain dehydrogenase; Provisional 97.02
PRK06196 315 oxidoreductase; Provisional 97.02
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.01
TIGR00507 270 aroE shikimate 5-dehydrogenase. This model finds p 97.0
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 97.0
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 97.0
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 96.99
PRK09186 256 flagellin modification protein A; Provisional 96.99
PRK05854 313 short chain dehydrogenase; Provisional 96.97
PRK07067 257 sorbitol dehydrogenase; Provisional 96.97
PRK05875 276 short chain dehydrogenase; Provisional 96.97
PRK07109 334 short chain dehydrogenase; Provisional 96.96
PRK08628 258 short chain dehydrogenase; Provisional 96.95
PRK08085 254 gluconate 5-dehydrogenase; Provisional 96.95
PRK08643 256 acetoin reductase; Validated 96.94
PRK09242 257 tropinone reductase; Provisional 96.94
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.94
PRK07454 241 short chain dehydrogenase; Provisional 96.94
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 96.94
PRK07024 257 short chain dehydrogenase; Provisional 96.93
PRK06101 240 short chain dehydrogenase; Provisional 96.93
PRK06124 256 gluconate 5-dehydrogenase; Provisional 96.93
PRK06914 280 short chain dehydrogenase; Provisional 96.92
PRK07774 250 short chain dehydrogenase; Provisional 96.92
PRK06181 263 short chain dehydrogenase; Provisional 96.92
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.91
PRK07453 322 protochlorophyllide oxidoreductase; Validated 96.91
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.91
PRK07904 253 short chain dehydrogenase; Provisional 96.91
PRK05876 275 short chain dehydrogenase; Provisional 96.91
PRK05693 274 short chain dehydrogenase; Provisional 96.9
PRK06138 252 short chain dehydrogenase; Provisional 96.88
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 96.88
PRK08267 260 short chain dehydrogenase; Provisional 96.87
PRK06197 306 short chain dehydrogenase; Provisional 96.87
PRK05717 255 oxidoreductase; Validated 96.87
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.86
PRK08177 225 short chain dehydrogenase; Provisional 96.86
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.86
PRK08264 238 short chain dehydrogenase; Validated 96.85
PRK08226 263 short chain dehydrogenase; Provisional 96.85
PRK06847 375 hypothetical protein; Provisional 96.84
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 96.83
PRK08277 278 D-mannonate oxidoreductase; Provisional 96.83
PF00106 167 adh_short: short chain dehydrogenase alcohol dehyd 96.82
PRK08163 396 salicylate hydroxylase; Provisional 96.8
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 96.8
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 96.79
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.79
PLN00203 519 glutamyl-tRNA reductase 96.78
PRK07102 243 short chain dehydrogenase; Provisional 96.78
KOG1014|consensus 312 96.77
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.77
PRK08251 248 short chain dehydrogenase; Provisional 96.77
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.76
PRK06753 373 hypothetical protein; Provisional 96.75
PRK07074 257 short chain dehydrogenase; Provisional 96.75
PRK10538 248 malonic semialdehyde reductase; Provisional 96.74
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 96.74
PRK08862 227 short chain dehydrogenase; Provisional 96.74
PLN02253 280 xanthoxin dehydrogenase 96.73
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.71
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.71
PRK08589 272 short chain dehydrogenase; Validated 96.71
PRK12742 237 oxidoreductase; Provisional 96.7
PRK07832 272 short chain dehydrogenase; Provisional 96.7
PRK06198 260 short chain dehydrogenase; Provisional 96.69
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 96.67
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 96.67
PLN02520 529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.64
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 96.64
KOG2304|consensus 298 96.64
PRK06184 502 hypothetical protein; Provisional 96.63
PRK07856 252 short chain dehydrogenase; Provisional 96.63
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.62
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.61
PRK10669558 putative cation:proton antiport protein; Provision 96.61
PRK06484 520 short chain dehydrogenase; Validated 96.61
PRK06482 276 short chain dehydrogenase; Provisional 96.61
PRK06179 270 short chain dehydrogenase; Provisional 96.6
PF03721 185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 96.6
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.6
PRK07045 388 putative monooxygenase; Reviewed 96.59
PF02558 151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 96.59
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 96.59
PRK06719 157 precorrin-2 dehydrogenase; Validated 96.58
PRK07097 265 gluconate 5-dehydrogenase; Provisional 96.58
PRK07236 386 hypothetical protein; Provisional 96.57
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 96.57
PRK07190 487 hypothetical protein; Provisional 96.56
PRK08263 275 short chain dehydrogenase; Provisional 96.56
PRK08244 493 hypothetical protein; Provisional 96.56
PRK14967 223 putative methyltransferase; Provisional 96.56
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.55
PRK08340 259 glucose-1-dehydrogenase; Provisional 96.55
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.55
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 96.53
PF01210 157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.52
PLN02928 347 oxidoreductase family protein 96.51
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.51
KOG1502|consensus 327 96.51
KOG1207|consensus 245 96.51
PRK06475 400 salicylate hydroxylase; Provisional 96.51
PRK06523 260 short chain dehydrogenase; Provisional 96.49
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 96.49
PRK06398 258 aldose dehydrogenase; Validated 96.49
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 96.49
PRK12831 464 putative oxidoreductase; Provisional 96.48
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 96.47
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 96.47
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.47
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 96.46
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 96.46
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.46
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 96.46
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 96.45
PRK05868 372 hypothetical protein; Validated 96.45
PRK08328 231 hypothetical protein; Provisional 96.45
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 96.45
PRK12814 652 putative NADPH-dependent glutamate synthase small 96.44
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 96.44
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.44
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.44
PRK08013 400 oxidoreductase; Provisional 96.43
PRK05884 223 short chain dehydrogenase; Provisional 96.43
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 96.43
PLN02896 353 cinnamyl-alcohol dehydrogenase 96.43
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.42
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 96.42
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 96.41
PRK07538 413 hypothetical protein; Provisional 96.41
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.41
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.41
PRK07775 274 short chain dehydrogenase; Provisional 96.41
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.4
PLN02686 367 cinnamoyl-CoA reductase 96.39
PLN02583 297 cinnamoyl-CoA reductase 96.38
PRK13243 333 glyoxylate reductase; Reviewed 96.38
PRK09126 392 hypothetical protein; Provisional 96.37
PRK07806 248 short chain dehydrogenase; Provisional 96.37
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.37
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.36
PRK06126 545 hypothetical protein; Provisional 96.36
PRK06953 222 short chain dehydrogenase; Provisional 96.36
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 96.36
PRK12367 245 short chain dehydrogenase; Provisional 96.35
PRK06484 520 short chain dehydrogenase; Validated 96.35
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 96.35
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 96.35
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 96.34
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.34
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 96.33
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.33
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.32
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 96.32
TIGR02032 295 GG-red-SF geranylgeranyl reductase family. This mo 96.32
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 96.31
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 96.3
PRK06834 488 hypothetical protein; Provisional 96.3
PRK06114 254 short chain dehydrogenase; Provisional 96.29
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 96.29
PRK07577 234 short chain dehydrogenase; Provisional 96.28
KOG0725|consensus 270 96.28
PF13738 203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.28
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 96.28
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.27
PRK03562 621 glutathione-regulated potassium-efflux system prot 96.27
PRK06720 169 hypothetical protein; Provisional 96.27
PRK05650 270 short chain dehydrogenase; Provisional 96.26
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.25
PRK08303 305 short chain dehydrogenase; Provisional 96.25
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 96.24
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 96.24
PRK08410 311 2-hydroxyacid dehydrogenase; Provisional 96.24
PRK06940 275 short chain dehydrogenase; Provisional 96.23
PRK07340 304 ornithine cyclodeaminase; Validated 96.22
PRK03659 601 glutathione-regulated potassium-efflux system prot 96.21
COG0686 371 Ald Alanine dehydrogenase [Amino acid transport an 96.21
PRK06483 236 dihydromonapterin reductase; Provisional 96.2
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 96.2
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 96.2
PRK12480 330 D-lactate dehydrogenase; Provisional 96.2
TIGR02415 254 23BDH acetoin reductases. One member of this famil 96.19
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 96.17
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 96.17
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.17
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.16
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 96.16
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 96.16
PRK07574 385 formate dehydrogenase; Provisional 96.15
PRK06141 314 ornithine cyclodeaminase; Validated 96.14
PRK14982 340 acyl-ACP reductase; Provisional 96.14
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.14
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.13
PRK08132 547 FAD-dependent oxidoreductase; Provisional 96.13
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 96.13
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.12
PRK07588 391 hypothetical protein; Provisional 96.12
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.11
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.09
PRK07417 279 arogenate dehydrogenase; Reviewed 96.09
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 96.09
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.09
PRK09310 477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.09
PF07991 165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 96.08
PRK06185 407 hypothetical protein; Provisional 96.08
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.08
PLN02650 351 dihydroflavonol-4-reductase 96.08
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 96.07
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.07
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 96.07
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.07
PTZ00188 506 adrenodoxin reductase; Provisional 96.06
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.06
PRK09135 249 pteridine reductase; Provisional 96.06
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 96.06
PRK12743 256 oxidoreductase; Provisional 96.06
PRK06924 251 short chain dehydrogenase; Provisional 96.05
PRK12770 352 putative glutamate synthase subunit beta; Provisio 96.05
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.05
PRK06932 314 glycerate dehydrogenase; Provisional 96.05
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 96.04
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.04
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 96.04
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 96.04
PRK08223 287 hypothetical protein; Validated 96.03
PRK13984 604 putative oxidoreductase; Provisional 96.03
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 96.03
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.03
PRK07791 286 short chain dehydrogenase; Provisional 96.02
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.02
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 96.02
TIGR00292 254 thiazole biosynthesis enzyme. This enzyme is invol 96.01
PRK06436 303 glycerate dehydrogenase; Provisional 96.01
PRK09496 453 trkA potassium transporter peripheral membrane com 96.0
PRK09496 453 trkA potassium transporter peripheral membrane com 96.0
cd01483 143 E1_enzyme_family Superfamily of activating enzymes 95.99
PRK15116 268 sulfur acceptor protein CsdL; Provisional 95.99
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 95.99
PRK07201 657 short chain dehydrogenase; Provisional 95.99
PRK05855 582 short chain dehydrogenase; Validated 95.99
PRK06487 317 glycerate dehydrogenase; Provisional 95.98
PRK10157 428 putative oxidoreductase FixC; Provisional 95.98
PRK12746 254 short chain dehydrogenase; Provisional 95.98
PRK08294 634 phenol 2-monooxygenase; Provisional 95.98
CHL00194 317 ycf39 Ycf39; Provisional 95.98
PRK08278 273 short chain dehydrogenase; Provisional 95.97
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 95.97
TIGR02992 326 ectoine_eutC ectoine utilization protein EutC. Mem 95.97
PRK08291 330 ectoine utilization protein EutC; Validated 95.96
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.96
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 95.96
PRK04176 257 ribulose-1,5-biphosphate synthetase; Provisional 95.96
PRK08317 241 hypothetical protein; Provisional 95.95
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 95.95
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 95.94
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 95.94
cd01487 174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 95.94
PLN03139 386 formate dehydrogenase; Provisional 95.94
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 95.94
KOG0029|consensus 501 95.93
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.92
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 95.91
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.91
PRK08219 227 short chain dehydrogenase; Provisional 95.91
PF07992 201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 95.9
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.89
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.89
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.88
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.88
PRK12747 252 short chain dehydrogenase; Provisional 95.88
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 95.87
KOG1399|consensus 448 95.87
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 95.87
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.86
PRK12937 245 short chain dehydrogenase; Provisional 95.86
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 95.86
PLN02852 491 ferredoxin-NADP+ reductase 95.85
COG0281 432 SfcA Malic enzyme [Energy production and conversio 95.85
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 95.85
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.85
PRK00676 338 hemA glutamyl-tRNA reductase; Validated 95.85
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.85
>KOG0024|consensus Back     alignment and domain information
Probab=99.94  E-value=1.3e-26  Score=152.52  Aligned_cols=100  Identities=60%  Similarity=1.030  Sum_probs=96.4

Q ss_pred             CeeecCCCCCCcccceEEecCCceEECCCCCChhhhhcchhHHHHHHHHHhcCCCCCCEEEEEcCCHHHHHHHHHHHHcC
Q psy16556          1 MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYG   80 (100)
Q Consensus         1 ~~~~~~~~~~G~~ae~~~~~~~~~~~~p~~~~~~~aa~~~~~~ta~~~~~~~~~~~g~~vli~G~G~~G~~~~~l~~~~g   80 (100)
                      +.|++.++.+|++++|++.+++.++|+||++|+|++|+++|+++++||++++++++|++|||+|+||+|+.+...||.+|
T Consensus       114 m~f~atpp~~G~la~y~~~~~dfc~KLPd~vs~eeGAl~ePLsV~~HAcr~~~vk~Gs~vLV~GAGPIGl~t~l~Aka~G  193 (354)
T KOG0024|consen  114 MVFCATPPVDGTLAEYYVHPADFCYKLPDNVSFEEGALIEPLSVGVHACRRAGVKKGSKVLVLGAGPIGLLTGLVAKAMG  193 (354)
T ss_pred             cccccCCCcCCceEEEEEechHheeeCCCCCchhhcccccchhhhhhhhhhcCcccCCeEEEECCcHHHHHHHHHHHHcC
Confidence            46788889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEEEecChhhhhhhhcC
Q psy16556         81 ARVICVCKYVGIRIFPYKKI  100 (100)
Q Consensus        81 ~~~v~~~~~~~~~~~~~~~l  100 (100)
                      +.+|++++..+.|+++++++
T Consensus       194 A~~VVi~d~~~~Rle~Ak~~  213 (354)
T KOG0024|consen  194 ASDVVITDLVANRLELAKKF  213 (354)
T ss_pred             CCcEEEeecCHHHHHHHHHh
Confidence            99999999999999999874



>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>KOG0025|consensus Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1e3j_A 352 Ketose Reductase (Sorbitol Dehydrogenase) From Silv 7e-34
3qe3_A 355 Sheep Liver Sorbitol Dehydrogenase Length = 355 8e-31
1pl7_A 356 Human Sorbitol Dehydrogenase (Apo) Length = 356 8e-30
1pl6_A 356 Human SdhNADHINHIBITOR COMPLEX Length = 356 3e-29
3m6i_A 363 L-Arabinitol 4-Dehydrogenase Length = 363 3e-14
4a2c_A 346 Crystal Structure Of Galactitol-1-Phosphate Dehydro 2e-05
2dq4_A 343 Crystal Structure Of Threonine 3-Dehydrogenase Leng 3e-05
3fpl_A 351 Chimera Of Alcohol Dehydrogenase By Exchange Of The 2e-04
2nvb_A 352 Contribution Of Pro275 To The Thermostability Of Th 2e-04
1rjw_A 339 Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd 4e-04
1ykf_A 352 Nadp-Dependent Alcohol Dehydrogenase From Thermoana 4e-04
4ej6_A 370 Crystal Structure Of A Putative Zinc-Binding Dehydr 6e-04
3pii_A 339 Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog 7e-04
3gfb_A 350 L-Threonine Dehydrogenase (Tktdh) From The Hyperthe 8e-04
>pdb|1E3J|A Chain A, Ketose Reductase (Sorbitol Dehydrogenase) From Silverleaf Whitefly Length = 352 Back     alignment and structure

Iteration: 1

Score = 138 bits (348), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 62/88 (70%), Positives = 79/88 (89%) Query: 1 MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSV 60 + FCATPP GNL+++Y HAADFC+KLPD+++LEEGALLEPL+VGVHAC+R+GV LGT+V Sbjct: 113 LTFCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHACRRAGVQLGTTV 172 Query: 61 LVLSAGPIGLVTILAAKAYGARVICVCK 88 LV+ AGPIGLV++LAAKAYGA V+C + Sbjct: 173 LVIGAGPIGLVSVLAAKAYGAFVVCTAR 200
>pdb|3QE3|A Chain A, Sheep Liver Sorbitol Dehydrogenase Length = 355 Back     alignment and structure
>pdb|1PL7|A Chain A, Human Sorbitol Dehydrogenase (Apo) Length = 356 Back     alignment and structure
>pdb|1PL6|A Chain A, Human SdhNADHINHIBITOR COMPLEX Length = 356 Back     alignment and structure
>pdb|3M6I|A Chain A, L-Arabinitol 4-Dehydrogenase Length = 363 Back     alignment and structure
>pdb|4A2C|A Chain A, Crystal Structure Of Galactitol-1-Phosphate Dehydrogenase From Escherichia Coli Length = 346 Back     alignment and structure
>pdb|2DQ4|A Chain A, Crystal Structure Of Threonine 3-Dehydrogenase Length = 343 Back     alignment and structure
>pdb|3FPL|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of C. Beijerinckii Adh By T. Brockii Adh Length = 351 Back     alignment and structure
>pdb|2NVB|A Chain A, Contribution Of Pro275 To The Thermostability Of The Alcohol Dehydrogenases (Adhs) Length = 352 Back     alignment and structure
>pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 Back     alignment and structure
>pdb|1YKF|A Chain A, Nadp-Dependent Alcohol Dehydrogenase From Thermoanaerobium Brockii Length = 352 Back     alignment and structure
>pdb|4EJ6|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase (Target Psi-012003) From Sinorhizobium Meliloti 1021 Length = 370 Back     alignment and structure
>pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 Back     alignment and structure
>pdb|3GFB|A Chain A, L-Threonine Dehydrogenase (Tktdh) From The Hyperthermophilic Archaeon Thermococcus Kodakaraensis Length = 350 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 2e-42
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 2e-42
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 4e-39
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 4e-37
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 8e-36
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 5e-34
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 6e-31
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 3e-28
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 2e-24
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 7e-24
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 9e-12
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 2e-11
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 3e-09
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 4e-09
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 1e-08
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 3e-08
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 6e-08
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 2e-07
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 3e-07
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 4e-07
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 1e-06
4eye_A 342 Probable oxidoreductase; structural genomics, niai 1e-06
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 6e-06
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 1e-05
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 3e-05
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 3e-05
3gms_A 340 Putative NADPH:quinone reductase; structural genom 4e-05
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 5e-05
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 7e-05
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 1e-04
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 1e-04
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 3e-04
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 4e-04
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 6e-04
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
 Score =  140 bits (356), Expect = 2e-42
 Identities = 62/86 (72%), Positives = 78/86 (90%)

Query: 1   MVFCATPPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSV 60
           + FCATPP  GNL+++Y HAADFC+KLPD+++LEEGALLEPL+VGVHAC+R+GV LGT+V
Sbjct: 113 LTFCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHACRRAGVQLGTTV 172

Query: 61  LVLSAGPIGLVTILAAKAYGARVICV 86
           LV+ AGPIGLV++LAAKAYGA V+C 
Sbjct: 173 LVIGAGPIGLVSVLAAKAYGAFVVCT 198


>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.91
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.91
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 99.9
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 99.9
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 99.9
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.9
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 99.89
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.89
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.89
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.89
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.89
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.88
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.88
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 99.88
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.88
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 99.88
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.88
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 99.88
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.88
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.88
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.88
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 99.88
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.88
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 99.88
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.88
4eye_A 342 Probable oxidoreductase; structural genomics, niai 99.87
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.87
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 99.87
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 99.87
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 99.87
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.87
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.87
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.87
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 99.87
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.86
3gms_A 340 Putative NADPH:quinone reductase; structural genom 99.86
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 99.86
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 99.86
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 99.86
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.86
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 99.86
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 99.86
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 99.86
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.86
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 99.86
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.85
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 99.85
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 99.85
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.84
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.84
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.84
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.84
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 99.84
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.84
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 99.84
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 99.84
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 99.84
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 99.84
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 99.84
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.83
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 99.83
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.83
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.82
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.81
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 99.81
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.8
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.79
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 99.78
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.78
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 99.76
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 99.68
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.94
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 98.4
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.31
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.28
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 98.26
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.26
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.2
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.19
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.18
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.17
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 98.08
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.91
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.87
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 97.87
3c85_A 183 Putative glutathione-regulated potassium-efflux S 97.87
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.85
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.82
2yvl_A 248 TRMI protein, hypothetical protein; tRNA, methyltr 97.81
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.81
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 97.73
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.73
2rir_A 300 Dipicolinate synthase, A chain; structural genomic 97.7
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.67
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 97.62
3jyo_A 283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.61
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.61
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.61
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.6
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.55
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 97.55
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.54
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 97.52
1nyt_A 271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.5
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 97.49
2egg_A 297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.48
3tum_A 269 Shikimate dehydrogenase family protein; rossmann-f 97.48
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.47
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.47
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 97.47
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.46
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.46
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.46
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.46
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 97.46
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.45
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.44
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.44
1npy_A 271 Hypothetical shikimate 5-dehydrogenase-like protei 97.44
3pwz_A 272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.44
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 97.44
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.44
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.43
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 97.43
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.42
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 97.42
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.41
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 97.41
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 97.41
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 97.4
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.4
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.4
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 97.4
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 97.4
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 97.4
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.4
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.39
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.39
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 97.39
3imf_A 257 Short chain dehydrogenase; structural genomics, in 97.39
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 97.39
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.39
3o8q_A 281 Shikimate 5-dehydrogenase I alpha; structural geno 97.38
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 97.38
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.38
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.38
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.37
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.37
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.37
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 97.36
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.36
3grz_A 205 L11 mtase, ribosomal protein L11 methyltransferase 97.36
4dqx_A 277 Probable oxidoreductase protein; structural genomi 97.36
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 97.36
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.36
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 97.36
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.35
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.35
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 97.34
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 97.34
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.34
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 97.34
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.34
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 97.34
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 97.33
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.33
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.32
3u62_A 253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.32
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.32
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 97.32
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 97.32
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.32
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 97.32
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.32
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.31
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 97.31
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 97.31
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.31
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.31
3rih_A 293 Short chain dehydrogenase or reductase; structural 97.31
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 97.3
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 97.3
1id1_A 153 Putative potassium channel protein; RCK domain, E. 97.29
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.29
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.29
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.29
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.29
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.28
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 97.28
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 97.28
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 97.27
3cxt_A 291 Dehydrogenase with different specificities; rossma 97.26
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 97.26
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 97.26
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 97.26
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 97.26
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.26
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 97.25
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 97.25
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.25
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.25
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 97.24
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.24
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.24
1spx_A 278 Short-chain reductase family member (5L265); paral 97.24
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 97.23
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.23
1xkq_A 280 Short-chain reductase family member (5D234); parra 97.23
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.23
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 97.23
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 97.22
1p77_A 272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.22
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.22
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 97.22
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.21
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.21
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.21
3njr_A 204 Precorrin-6Y methylase; methyltransferase, decarbo 97.2
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 97.2
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.19
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 97.19
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 97.19
1xq1_A 266 Putative tropinone reducatse; structural genomics, 97.19
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 97.19
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.19
3phh_A 269 Shikimate dehydrogenase; shikimate pathway, helico 97.18
1xhl_A 297 Short-chain dehydrogenase/reductase family member 97.18
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 97.18
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.17
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.16
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 97.16
1jg1_A 235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.14
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 97.14
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.14
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.13
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 97.13
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 97.12
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.12
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 97.12
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 97.12
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 97.11
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 97.08
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 97.08
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.08
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 97.08
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 97.07
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 97.07
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 97.07
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 97.07
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 97.06
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 97.06
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 97.05
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.05
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.04
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.03
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.03
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 97.02
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 97.02
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.01
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 97.01
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 97.0
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.0
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 97.0
1xq6_A 253 Unknown protein; structural genomics, protein stru 96.99
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 96.99
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 96.98
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 96.98
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 96.98
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 96.98
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 96.97
2hk9_A 275 Shikimate dehydrogenase; shikimate pathway, drug d 96.97
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 96.97
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.97
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 96.97
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 96.97
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.96
3hm2_A 178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.96
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 96.95
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 96.95
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 96.94
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.94
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 96.94
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 96.94
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 96.93
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 96.93
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 96.93
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 96.93
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.93
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 96.92
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.92
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 96.92
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.92
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.92
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 96.91
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 96.91
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.9
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 96.9
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 96.9
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.9
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 96.9
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 96.9
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 96.89
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 96.89
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.88
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 96.88
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 96.88
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 96.88
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.88
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 96.87
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 96.87
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 96.86
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.86
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.85
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 96.85
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 96.83
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 96.83
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.82
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 96.82
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.81
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 96.81
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 96.81
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.8
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.8
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 96.79
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 96.79
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.79
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.78
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 96.78
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 96.78
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 96.78
2d5c_A 263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 96.77
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 96.77
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 96.77
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 96.77
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 96.77
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 96.77
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 96.77
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.76
2pwy_A 258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.76
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 96.75
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.75
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 96.74
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 96.74
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.73
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 96.73
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 96.72
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.72
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.7
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.7
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.69
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 96.69
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 96.68
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.67
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.67
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 96.66
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 96.66
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.66
2we8_A 386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 96.65
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.65
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 96.65
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 96.64
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 96.64
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 96.64
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 96.64
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.63
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 96.63
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 96.63
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 96.62
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 96.61
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 96.61
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 96.61
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 96.61
3mti_A 185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 96.6
1fbn_A 230 MJ fibrillarin homologue; MJ proteins, ribosomal R 96.6
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.6
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 96.6
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 96.59
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.59
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 96.59
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.58
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 96.58
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.57
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 96.57
3mb5_A 255 SAM-dependent methyltransferase; RNA methyltransfe 96.57
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 96.57
2ywl_A 180 Thioredoxin reductase related protein; uncharacter 96.56
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 96.56
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 96.55
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.54
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 96.54
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.54
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 96.54
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 96.54
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.53
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 96.52
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 96.52
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.51
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 96.5
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.5
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 96.5
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.5
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 96.5
2bry_A 497 NEDD9 interacting protein with calponin homology a 96.49
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 96.49
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 96.49
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 96.49
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.49
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.48
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.48
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 96.48
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.47
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 96.47
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 96.46
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 96.46
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.46
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 96.45
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 96.45
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.45
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.44
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 96.44
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.44
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 96.44
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.44
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.43
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 96.43
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 96.42
2b25_A 336 Hypothetical protein; structural genomics, methyl 96.42
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 96.41
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 96.4
3on5_A 362 BH1974 protein; structural genomics, joint center 96.4
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 96.4
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 96.4
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 96.4
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.39
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.39
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 96.38
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.38
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 96.38
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.38
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 96.37
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.37
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 96.37
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 96.37
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 96.37
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 96.35
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 96.33
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 96.33
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 96.33
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 96.33
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.32
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.32
1i1n_A 226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.32
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.32
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 96.32
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.31
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.31
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 96.3
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 96.3
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.3
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 96.3
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.3
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 96.29
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.29
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 96.29
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.28
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 96.28
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.28
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 96.27
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 96.26
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 96.26
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 96.26
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 96.25
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.25
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.25
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 96.24
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.23
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 96.23
2i99_A 312 MU-crystallin homolog; thyroid hormine binding pro 96.22
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.22
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 96.21
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 96.21
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 96.2
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.2
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 96.19
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.19
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 96.19
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 96.18
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.18
2cul_A 232 Glucose-inhibited division protein A-related PROT 96.17
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.17
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 96.17
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.17
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 96.16
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 96.16
2nyu_A 196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.16
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.16
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 96.15
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 96.15
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 96.15
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 96.14
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
Probab=99.91  E-value=6.5e-24  Score=142.52  Aligned_cols=93  Identities=42%  Similarity=0.684  Sum_probs=86.9

Q ss_pred             CCCCCcccceEEecCCceEECCCCCChhhhhcchhHHHHHHHHHhcCCCCCCEEEEEcCCHHHHHHHHHHHHcCCcEEEE
Q psy16556          7 PPHHGNLSQFYKHAADFCYKLPDHLTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICV   86 (100)
Q Consensus         7 ~~~~G~~ae~~~~~~~~~~~~p~~~~~~~aa~~~~~~ta~~~~~~~~~~~g~~vli~G~G~~G~~~~~l~~~~g~~~v~~   86 (100)
                      .+.+|+|+||+++|++.++++|+ +++++|++++++.|||++++..++++|++|||+|+|++|++++|++|.+|+++|++
T Consensus       131 ~~~~G~~aey~~v~~~~~~~iP~-~s~~~aa~~~~~~ta~~~l~~~~~~~g~~VlV~GaG~vG~~aiqlak~~Ga~~Vi~  209 (363)
T 3m6i_A          131 PPVPGLLRRYVNHPAVWCHKIGN-MSYENGAMLEPLSVALAGLQRAGVRLGDPVLICGAGPIGLITMLCAKAAGACPLVI  209 (363)
T ss_dssp             TTSCCSCBSEEEEEGGGEEECTT-CCHHHHHHHHHHHHHHHHHHHHTCCTTCCEEEECCSHHHHHHHHHHHHTTCCSEEE
T ss_pred             CCCCccceeEEEEehhhEEECCC-CCHHHHHhhhHHHHHHHHHHHcCCCCCCEEEEECCCHHHHHHHHHHHHcCCCEEEE
Confidence            34579999999999999999999 99999998889999999999899999999999999999999999999999987999


Q ss_pred             EecChhhhhhhhcC
Q psy16556         87 CKYVGIRIFPYKKI  100 (100)
Q Consensus        87 ~~~~~~~~~~~~~l  100 (100)
                      ++++++|+++++++
T Consensus       210 ~~~~~~~~~~a~~l  223 (363)
T 3m6i_A          210 TDIDEGRLKFAKEI  223 (363)
T ss_dssp             EESCHHHHHHHHHH
T ss_pred             ECCCHHHHHHHHHh
Confidence            99999999988763



>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 100
d1pl8a2 171 c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh 6e-12
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 1e-11
d1e3ja2170 c.2.1.1 (A:143-312) Ketose reductase (sorbitol deh 9e-11
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 1e-10
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 3e-09
d1kola2 195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 9e-08
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 3e-07
d1rjwa1171 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase 5e-07
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 1e-06
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 5e-06
d1jqba2 174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 9e-06
d1h2ba1171 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas 1e-05
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 2e-05
d1tt7a1162 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein 3e-05
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 3e-05
d1jqba1177 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon 9e-05
d1jvba1177 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase 1e-04
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 8e-04
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 0.001
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 0.002
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 0.002
d1qo8a2 317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 0.004
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Ketose reductase (sorbitol dehydrogenase)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.4 bits (135), Expect = 6e-12
 Identities = 36/57 (63%), Positives = 43/57 (75%)

Query: 32 TLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCK 88
          T EEGAL+EPL+VG+HAC+R GV LG  VLV  AGPIG+VT+L AKA GA  + V  
Sbjct: 2  TFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTD 58


>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 170 Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
d1pl8a2 171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.79
d1e3ja2 170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.79
d1jqba2 174 Bacterial secondary alcohol dehydrogenase {Clostri 99.78
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.76
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.76
d2fzwa2 176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.76
d1e3ia2 174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.75
d1p0fa2 174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.75
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.75
d1yb5a2 174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.75
d1d1ta2 176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.75
d1qora2 179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.73
d2jhfa2 176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.72
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.72
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.71
d1vj0a2 182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.71
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.71
d1cdoa2 175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.69
d1f8fa2 174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.68
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.68
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.67
d1xa0a2 176 B. subtilis YhfP homologue {Bacillus stearothermop 99.66
d1pqwa_ 183 Putative enoyl reductase domain of polyketide synt 99.65
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.63
d1v3va2 182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.63
d1gu7a2 189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.55
d1o89a2 177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.55
d1vj1a2 187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.51
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.5
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.4
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.35
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.3
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.28
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.26
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.24
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.19
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.18
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.16
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.1
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.06
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.99
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 98.9
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.9
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 98.84
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 98.83
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.77
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 98.75
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 98.69
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 98.62
d1npya1 167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.27
d1l7da1 183 Nicotinamide nucleotide transhydrogenase dI compon 98.26
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.13
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.02
d1nyta1 170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.97
d1e5qa1 182 Saccharopine reductase {Rice blast fungus (Magnapo 97.96
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 97.93
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.9
d1vi2a1 182 Putative shikimate dehydrogenase YdiB {Escherichia 97.87
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.85
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.84
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 97.83
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.81
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.79
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.78
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 97.77
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.75
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.73
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 97.73
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.73
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.72
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.71
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.71
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.7
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 97.7
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.69
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.69
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 97.68
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.68
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 97.68
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.68
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.68
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 97.67
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.67
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 97.66
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.65
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.65
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.64
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 97.63
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 97.63
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.62
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.62
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 97.61
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.61
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 97.59
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.59
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 97.59
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.59
d1p77a1 171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.58
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.57
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 97.57
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.57
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.56
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 97.56
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 97.55
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.55
d2f1ka2 165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.52
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.52
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.52
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 97.47
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 97.47
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 97.46
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 97.43
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.43
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 97.41
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 97.4
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.4
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.39
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 97.38
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.38
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.35
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 97.34
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.34
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.33
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 97.32
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.32
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.31
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.29
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 97.28
d2g5ca2 171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.27
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.27
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 97.26
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.26
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.25
d1nvta1 177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.24
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.24
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 97.24
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.23
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 97.23
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.22
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.19
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.19
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 97.17
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 97.16
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 97.14
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.13
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 97.13
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.12
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.11
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 97.11
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.1
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.1
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 97.09
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 97.09
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 97.09
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.08
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus 97.05
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.05
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.03
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.01
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.01
d1pzga1 154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.0
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.0
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 97.0
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.0
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.99
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.99
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.99
d1yqga2 152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.99
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.99
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.98
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.98
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.97
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.97
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.93
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.93
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 96.91
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 96.91
d1fl2a1 184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.88
d1mx3a1 193 Transcription corepressor CtbP {Human (Homo sapien 96.87
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.85
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.83
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 96.83
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 96.82
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.81
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.8
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.8
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.79
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.79
d1o54a_ 266 Hypothetical protein TM0748 {Thermotoga maritima [ 96.78
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.78
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 96.77
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.77
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.76
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 96.76
d1ks9a2 167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.73
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 96.71
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.69
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.68
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 96.67
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 96.66
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 96.66
d3lada1 229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.65
d1i1na_ 224 Protein-L-isoaspartyl O-methyltransferase {Human ( 96.64
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 96.64
d1vdca1 192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.64
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 96.64
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.63
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.62
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 96.61
d1t2da1 150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.6
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 96.6
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.59
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 96.59
d1vbfa_ 224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 96.58
d1n1ea2 189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.58
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 96.57
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 96.56
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 96.54
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 96.53
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 96.52
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 96.52
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 96.51
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 96.5
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.48
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.47
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.47
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.46
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.42
d1vpda2 161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.41
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 96.39
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 96.36
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 96.35
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.35
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 96.32
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 96.31
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 96.31
d1gdha1 191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.3
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 96.29
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 96.29
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 96.27
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.27
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 96.23
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.23
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 96.21
d1i9ga_ 264 Probable methyltransferase Rv2118c {Mycobacterium 96.2
d1sc6a1 188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.19
d2ahra2 152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.18
d2pgda2 176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.17
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 96.17
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 96.15
d1nt2a_ 209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.15
d1pgja2 178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.11
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 96.11
d1id1a_ 153 Rck domain from putative potassium channel Kch {Es 96.11
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.11
d2naca1 188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.09
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 96.09
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 96.08
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 96.05
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 96.02
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 96.02
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.01
d1hyha1 146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.01
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 96.01
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 95.99
d3cuma2 162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.98
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 95.98
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 95.93
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.92
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 95.91
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 95.91
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.9
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 95.88
d1u2za_ 406 Catalytic, N-terminal domain of histone methyltran 95.88
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 95.85
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 95.83
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 95.82
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 95.8
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 95.74
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 95.72
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 95.71
d2cula1 230 GidA-related protein TTHA1897 {Thermus thermophilu 95.71
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.7
d1g8aa_ 227 Fibrillarin homologue {Archaeon Pyrococcus horikos 95.69
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.68
d1g8sa_ 230 Fibrillarin homologue {Archaeon Methanococcus jann 95.68
d1mo9a1 261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.63
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 95.62
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 95.6
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 95.58
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 95.56
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 95.5
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.49
d1aoga1 238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 95.47
d1l3ia_ 186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 95.46
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 95.37
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 95.35
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.32
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.29
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 95.29
d1feca1 240 Trypanothione reductase {Crithidia fasciculata [Ta 95.27
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 95.18
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 95.06
d1xdia1 233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 95.06
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.05
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.99
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 94.96
d1ne2a_ 197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 94.94
d1i36a2 152 Conserved hypothetical protein MTH1747 {Archaeon M 94.82
d1zx0a1 229 Guanidinoacetate methyltransferase {Human (Homo sa 94.78
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.72
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.62
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 94.59
d1txga2 180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.58
d1d7ya1 183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.57
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.55
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 94.53
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 94.5
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 94.49
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.47
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 94.47
d1xhca1 167 NADH oxidase /nitrite reductase {Pyrococcus furios 94.43
d1nhpa1 198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.43
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 94.39
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.36
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.3
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 94.21
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 94.11
d1cjca1 225 Adrenodoxin reductase of mitochondrial p450 system 93.99
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 93.99
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 93.94
d2frna1 260 Hypothetical protein PH0793 {Pyrococcus horikoshii 93.93
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 93.92
d1omoa_ 320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 93.82
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 93.76
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 93.72
d1lqta1 216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 93.69
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 93.54
d1x7da_ 340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 93.42
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 93.39
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 93.33
d3bswa1 193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 93.26
d1obba1 171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 93.24
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 93.2
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.16
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 93.09
d1jbqa_ 355 Cystathionine beta-synthase {Human (Homo sapiens) 93.04
d1kf6a2 311 Fumarate reductase {Escherichia coli [TaxId: 562]} 92.97
d1r0ka2 150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 92.96
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 92.95
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 92.93
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 92.87
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 92.77
d2bhsa1 292 O-acetylserine sulfhydrylase (Cysteine synthase) { 92.74
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 92.69
d1np3a2 182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 92.64
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 92.46
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 92.45
d1dusa_ 194 Hypothetical protein MJ0882 {Archaeon Methanococcu 92.38
d1xeaa1 167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 92.27
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 92.15
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 91.95
d1q0qa2 151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 91.83
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.68
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.43
d1wy7a1 201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 91.4
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 91.11
d1ydwa1 184 Probable oxidoreductase At4g09670 {Thale cress (Ar 90.84
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.47
d2i76a2 153 Hypothetical protein TM1727 {Thermotoga maritima [ 90.42
d1iy9a_ 274 Spermidine synthase {Bacillus subtilis [TaxId: 142 90.38
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 90.36
d1m6ia1 213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 90.16
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 90.1
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 89.98
d1nvmb1 157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 89.96
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.93
d2ex4a1 222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 89.75
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 89.67
d1up7a1 162 6-phospho-beta-glucosidase {Thermotoga maritima [T 89.61
d1wkva1 382 O-acetylserine sulfhydrylase (Cysteine synthase) { 89.5
d1inla_ 295 Spermidine synthase {Thermotoga maritima [TaxId: 2 89.41
d1y7la1 310 O-acetylserine sulfhydrylase (Cysteine synthase) { 89.34
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 89.29
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 89.2
d1u8xx1 167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 89.01
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 88.9
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 88.78
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 88.74
d2o07a1 285 Spermidine synthase {Human (Homo sapiens) [TaxId: 88.63
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 88.57
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 88.52
d2cvza2 156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 88.41
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 88.15
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.07
d1xtpa_ 254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 87.87
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 87.67
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 87.62
d2as0a2 324 Hypothetical protein PH1915, middle and C-terminal 87.6
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 87.43
d1vjta1 193 Putative alpha-glucosidase TM0752 {Thermotoga mari 87.08
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 87.08
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 87.04
d1f06a1 170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 87.0
d2b2ca1 312 Spermidine synthase {Caenorhabditis elegans [TaxId 86.83
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 86.67
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 86.12
d1fcja_ 302 O-acetylserine sulfhydrylase (Cysteine synthase) { 86.07
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 85.78
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 85.74
d1tlta1 164 Virulence factor MviM {Escherichia coli [TaxId: 56 85.57
d1z7wa1 320 O-acetylserine sulfhydrylase (Cysteine synthase) { 85.57
d2gz1a1 154 Aspartate beta-semialdehyde dehydrogenase {Strepto 85.4
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 84.75
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 84.61
d2csua3 163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 83.55
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 83.53
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 83.4
d2b78a2 317 Hypothetical protein SMu776, middle and C-terminal 83.38
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 83.27
d1wxxa2 318 Hypothetical protein TTHA1280, middle and C-termin 83.21
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 82.48
d1v7ca_ 351 Threonine synthase {Thermus thermophilus [TaxId: 2 82.45
d1h6da1 221 Glucose-fructose oxidoreductase, N-terminal domain 82.32
d1p3da2152 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 82.24
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 82.21
d1qmga2 226 Class II ketol-acid reductoisomerase (KARI) {Spina 82.17
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 81.99
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 81.66
d1pvva2 163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 81.35
d1s6ya1 169 6-phospho-beta-glucosidase {Bacillus stearothermop 81.28
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 80.41
d1zh8a1 181 Hypothetical protein TM0312 {Thermotoga maritima [ 80.16
d2cvoa1 183 Putative semialdehyde dehydrogenase {Rice (Oryza s 80.04
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 80.01
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Ketose reductase (sorbitol dehydrogenase)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79  E-value=2.7e-19  Score=107.91  Aligned_cols=70  Identities=56%  Similarity=0.898  Sum_probs=66.4

Q ss_pred             CChhhhhcchhHHHHHHHHHhcCCCCCCEEEEEcCCHHHHHHHHHHHHcCCcEEEEEecChhhhhhhhcC
Q psy16556         31 LTLEEGALLEPLAVGVHACKRSGVGLGTSVLVLSAGPIGLVTILAAKAYGARVICVCKYVGIRIFPYKKI  100 (100)
Q Consensus        31 ~~~~~aa~~~~~~ta~~~~~~~~~~~g~~vli~G~G~~G~~~~~l~~~~g~~~v~~~~~~~~~~~~~~~l  100 (100)
                      +|+++|++++|++++||++++.++++|++|+|+|+|++|++++|+++.+|+++|++++++++|+++++++
T Consensus         1 vS~e~Aal~epla~a~~a~~~~~~~~gd~VlI~G~G~iG~~~~~~a~~~G~~~Vi~~d~~~~rl~~a~~~   70 (171)
T d1pl8a2           1 VTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEI   70 (171)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHTCCTTCEEEEECCSHHHHHHHHHHHHTTCSEEEEEESCHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHHHHHHHHHhCCCCCCEEEEECCCccHHHHHHHHHHcCCceEEeccCCHHHHHHHHHh
Confidence            5789999999999999999999999999999999999999999999999998799999999999999874



>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1p3da2 c.59.1.1 (A:322-473) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure