Diaphorina citri psyllid: psy16582


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQRRATIPR
ccHHHHHHHHcccccEEEEccccccccccccccEEEEccccccHHHHHHHHHHcccccccEEEEECccccHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHcccc
*DVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQR******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQRRATIPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Endoribonuclease dcr-1 Involved in cleaving double-stranded RNA in the RNA interference (RNAi) pathway. It produces 21 to 23 bp dsRNAs (siRNAs) which target the selective destruction of homologous RNAs. Seems to process the precursor of the small temporal RNA let-7 which is involved in developmental timing.confidentP34529
Endoribonuclease Dicer Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of dicer1, eif2c2/ago2 and tarbp2. Within the RLC/miRLC, dicer1 and tarbp2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto eif2c2/ago2. eif2c2/ago2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from dicer1 and tarbp2. Also cleaves double-stranded RNA to produce short interfering RNAs (siRNAs) which target the selective destruction of complementary RNAs.confidentB3DLA6
Endoribonuclease Dicer homolog 2 Ribonuclease (RNase) III involved in RNA-mediated post-transcriptional gene silencing (PTGS). Involved in the processing of natural small interfering RNAs (nat-siRNAs, derived from cis-natural antisense transcripts) by cleaving small dsRNAs into 24 nucleotide nat-siRNAs. Plays an essential role in transitive silencing of transgenes by processing secondary siRNAs. This pathway, which requires DCL4 and RDR6, amplifies silencing by using the target RNA as substrate to generate secondary siRNAs, providing an efficient mechanism for long-distance silencing. May participate with DCL3 in the production of 24 nucleotide repeat-associated siRNAs (ra-siRNAs) which derive from heterochromatin and DNA repeats such as transposons. Plays a role in antiviral RNA silencing. Involved in the production of viral siRNAs derived from the turnip crinkle virus (TCV) and tobacco rattle virus (TRV). Targeted by the viral silencing suppressor (VSR) protein 2b of the cucumber mosaic virus (CMV) that inactivates DCL2 function in RNA silencing. Does not seem to be involved in microRNAs (miRNAs) processing.confidentQ3EBC8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004530 [MF]deoxyribonuclease I activityprobableGO:0016787, GO:0016893, GO:0004536, GO:0004519, GO:0003824, GO:0004520, GO:0016788, GO:0004518, GO:0003674, GO:0016888
GO:0030422 [BP]production of siRNA involved in RNA interferenceprobableGO:0009892, GO:0019222, GO:0090304, GO:0031050, GO:0010629, GO:0006807, GO:0070887, GO:0050789, GO:0044699, GO:0070918, GO:0006139, GO:0051716, GO:0010605, GO:0044260, GO:0071359, GO:0010608, GO:1901360, GO:0040029, GO:0071704, GO:0010467, GO:0065007, GO:0014070, GO:0016246, GO:0010468, GO:0060255, GO:0009987, GO:0006725, GO:0071310, GO:0044763, GO:0031047, GO:0008152, GO:0048519, GO:0042221, GO:0010033, GO:0046483, GO:0016070, GO:0044238, GO:0016458, GO:0035194, GO:0071407, GO:1901698, GO:1901699, GO:0034641, GO:0044237, GO:0043170, GO:0043331, GO:0016441, GO:0008150, GO:0050896, GO:0006396
GO:0035198 [MF]miRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016442 [CC]RNA-induced silencing complexprobableGO:0032991, GO:0031332, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0070883 [MF]pre-miRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0004525 [MF]ribonuclease III activityprobableGO:0016787, GO:0003824, GO:0004518, GO:0004519, GO:0004540, GO:0004521, GO:0016788, GO:0016893, GO:0016891, GO:0003674
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031054 [BP]pre-miRNA processingprobableGO:0009892, GO:0019222, GO:0050896, GO:0040029, GO:0090304, GO:0031050, GO:0010629, GO:0006807, GO:0070887, GO:0034660, GO:0050789, GO:0044699, GO:0070918, GO:0006139, GO:0051716, GO:0010605, GO:0044260, GO:0071359, GO:0010608, GO:1901360, GO:0010467, GO:0071704, GO:0016458, GO:0065007, GO:0014070, GO:0048519, GO:0010468, GO:0034470, GO:0060255, GO:0009987, GO:0006725, GO:0071310, GO:0044763, GO:0031047, GO:0008152, GO:0042221, GO:0010033, GO:0046483, GO:0016070, GO:0044238, GO:0035194, GO:0035195, GO:0035196, GO:1901699, GO:0034641, GO:0044237, GO:0043170, GO:0043331, GO:0071407, GO:0016441, GO:0008150, GO:1901698, GO:0006396
GO:0003725 [MF]double-stranded RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0000737 [BP]DNA catabolic process, endonucleolyticprobableGO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0006308, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0006401 [BP]RNA catabolic processprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EIQ, chain A
Confidence level:very confident
Coverage over the Query: 1-72
View the alignment between query and template
View the model in PyMOL
Template: 2DB3, chain A
Confidence level:very confident
Coverage over the Query: 1-98
View the alignment between query and template
View the model in PyMOL