Psyllid ID: psy16582

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQRRATIPR
ccHHHHHHHHcccccEEEEccccccccccccccEEEEccccccHHHHHHHHHHcccccccEEEEEEcccHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHccc
ccHHHHHHHHcccEEEEEEHHHHHcccccccccEEEEEcccccHHHHHHHccHHHHHHHHHHHHHcccccHHHHHccHHHHHHHHHHHHHccccHHHHHHHHccccccc
MDVQTMLSFNRGITNILVATDVLeegidiqscnlvikfdppqhtrsyvqskaFTVVRHKAEQILsqypkserylqynspKINRLLQLLRRynpdqrtiifcqrratipr
mdvqtmlsfnrgITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILsqypkserylqynsPKINRLLQLLrrynpdqrtiifcqrratipr
MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQRRATIPR
*****MLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQR******
*DVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKI*********************R******
MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQRRATIPR
*DVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQRRA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPKINRLLQLLRRYNPDQRTIIFCQRRATIPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q3EBC8 1388 Endoribonuclease Dicer ho yes N/A 0.403 0.031 0.590 2e-10
P34529 1910 Endoribonuclease dcr-1 OS yes N/A 0.403 0.023 0.636 1e-09
Q5N870 1651 Endoribonuclease Dicer ho yes N/A 0.559 0.036 0.492 6e-09
A0MQH0 1917 Endoribonuclease Dicer OS yes N/A 0.449 0.025 0.530 1e-08
Q8R418 1916 Endoribonuclease Dicer OS yes N/A 0.449 0.025 0.530 1e-08
B3DLA6 1893 Endoribonuclease Dicer OS yes N/A 0.449 0.025 0.510 2e-08
Q9UPY3 1922 Endoribonuclease Dicer OS yes N/A 0.357 0.020 0.615 2e-08
Q25BN1 1921 Endoribonuclease Dicer OS yes N/A 0.449 0.025 0.510 2e-08
Q6TUI4 1923 Endoribonuclease Dicer OS yes N/A 0.357 0.020 0.615 2e-08
Q6TV19 1865 Endoribonuclease Dicer OS yes N/A 0.449 0.026 0.510 2e-08
>sp|Q3EBC8|DCL2_ARATH Endoribonuclease Dicer homolog 2 OS=Arabidopsis thaliana GN=At3g03300 PE=1 SV=2 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 36/44 (81%)

Query: 9   FNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKA 52
           F RG+ NI+VAT +LEEG+D+QSCNLVI+FDP  +  S++QS+ 
Sbjct: 444 FRRGLVNIIVATSILEEGLDVQSCNLVIRFDPASNICSFIQSRG 487
Ribonuclease (RNase) III involved in RNA-mediated post-transcriptional gene silencing (PTGS). Involved in the processing of natural small interfering RNAs (nat-siRNAs, derived from cis-natural antisense transcripts) by cleaving small dsRNAs into 24 nucleotide nat-siRNAs. Plays an essential role in transitive silencing of transgenes by processing secondary siRNAs. This pathway, which requires DCL4 and RDR6, amplifies silencing by using the target RNA as substrate to generate secondary siRNAs, providing an efficient mechanism for long-distance silencing. May participate with DCL3 in the production of 24 nucleotide repeat-associated siRNAs (ra-siRNAs) which derive from heterochromatin and DNA repeats such as transposons. Plays a role in antiviral RNA silencing. Involved in the production of viral siRNAs derived from the turnip crinkle virus (TCV) and tobacco rattle virus (TRV). Targeted by the viral silencing suppressor (VSR) protein 2b of the cucumber mosaic virus (CMV) that inactivates DCL2 function in RNA silencing. Does not seem to be involved in microRNAs (miRNAs) processing.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: 6EC: .EC: -
>sp|P34529|DCR1_CAEEL Endoribonuclease dcr-1 OS=Caenorhabditis elegans GN=dcr-1 PE=1 SV=3 Back     alignment and function description
>sp|Q5N870|DCL3A_ORYSJ Endoribonuclease Dicer homolog 3a OS=Oryza sativa subsp. japonica GN=DCL3A PE=2 SV=1 Back     alignment and function description
>sp|A0MQH0|DICER_CRIGR Endoribonuclease Dicer OS=Cricetulus griseus GN=DICER1 PE=2 SV=3 Back     alignment and function description
>sp|Q8R418|DICER_MOUSE Endoribonuclease Dicer OS=Mus musculus GN=Dicer1 PE=1 SV=3 Back     alignment and function description
>sp|B3DLA6|DICER_XENTR Endoribonuclease Dicer OS=Xenopus tropicalis GN=dicer1 PE=2 SV=2 Back     alignment and function description
>sp|Q9UPY3|DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens GN=DICER1 PE=1 SV=3 Back     alignment and function description
>sp|Q25BN1|DICER_CHICK Endoribonuclease Dicer OS=Gallus gallus GN=DICER1 PE=2 SV=3 Back     alignment and function description
>sp|Q6TUI4|DICER_BOVIN Endoribonuclease Dicer OS=Bos taurus GN=DICER1 PE=2 SV=3 Back     alignment and function description
>sp|Q6TV19|DICER_DANRE Endoribonuclease Dicer OS=Danio rerio GN=dicer1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
444841769 1448 Dicer 2 [Nilaparvata lugens] 0.532 0.040 0.568 8e-12
388565188 1656 dicer-2 [Nilaparvata lugens] 0.532 0.035 0.568 8e-12
444841767 1654 Dicer 2 [Laodelphax striatella] 0.605 0.039 0.530 2e-11
406034947 1649 Dicer 2 [Blattella germanica] 0.688 0.045 0.464 6e-10
346327498 1392 RNA helicase/RNAse III, putative [Cordyc 0.908 0.071 0.371 6e-10
224109196 1408 dicer-like protein [Populus trichocarpa] 0.477 0.036 0.519 1e-09
400598379 1402 RNase3 domain-containing protein [Beauve 0.908 0.070 0.353 2e-09
378405592 1502 dicer-2 [Marsupenaeus japonicus] 0.449 0.032 0.551 3e-09
341893002 1927 CBN-DCR-1 protein [Caenorhabditis brenne 0.403 0.022 0.636 3e-09
340372191 1530 PREDICTED: endoribonuclease Dicer-like [ 0.449 0.032 0.591 4e-09
>gi|444841769|gb|AGE12617.1| Dicer 2 [Nilaparvata lugens] Back     alignment and taxonomy information
 Score = 74.3 bits (181), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 42/58 (72%)

Query: 9   FNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQ 66
           FN G TN+L+A+DVLEEGID+Q+CN VIKFDPP   RSY+QSK     R     I+++
Sbjct: 341 FNGGDTNVLIASDVLEEGIDVQTCNTVIKFDPPTTMRSYIQSKGRARTRQSKFYIMTE 398

Source: Nilaparvata lugens

Species: Nilaparvata lugens

Genus: Nilaparvata

Family: Delphacidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|388565188|gb|AFK73581.1| dicer-2 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|444841767|gb|AGE12616.1| Dicer 2 [Laodelphax striatella] Back     alignment and taxonomy information
>gi|406034947|emb|CCF23094.1| Dicer 2 [Blattella germanica] Back     alignment and taxonomy information
>gi|346327498|gb|EGX97094.1| RNA helicase/RNAse III, putative [Cordyceps militaris CM01] Back     alignment and taxonomy information
>gi|224109196|ref|XP_002315119.1| dicer-like protein [Populus trichocarpa] gi|222864159|gb|EEF01290.1| dicer-like protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|400598379|gb|EJP66096.1| RNase3 domain-containing protein [Beauveria bassiana ARSEF 2860] Back     alignment and taxonomy information
>gi|378405592|gb|AFB82635.1| dicer-2 [Marsupenaeus japonicus] Back     alignment and taxonomy information
>gi|341893002|gb|EGT48937.1| CBN-DCR-1 protein [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|340372191|ref|XP_003384628.1| PREDICTED: endoribonuclease Dicer-like [Amphimedon queenslandica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
TAIR|locus:2097705 1388 DCL2 "dicer-like 2" [Arabidops 0.394 0.030 0.604 2e-09
UNIPROTKB|F1NJX0 1921 DICER1 "Endoribonuclease Dicer 0.440 0.024 0.520 8e-09
UNIPROTKB|Q25BN1 1921 DICER1 "Endoribonuclease Dicer 0.440 0.024 0.520 8e-09
UNIPROTKB|F1NP11 1925 DICER1 "Endoribonuclease Dicer 0.440 0.024 0.520 8e-09
WB|WBGene00000939 1910 dcr-1 [Caenorhabditis elegans 0.440 0.025 0.583 1.3e-08
UNIPROTKB|B3DLA6 1893 dicer1 "Endoribonuclease Dicer 0.440 0.025 0.520 1.6e-08
UNIPROTKB|A0MQH0 1917 DICER1 "Endoribonuclease Dicer 0.440 0.025 0.541 1.6e-08
MGI|MGI:2177178 1916 Dicer1 "dicer 1, ribonuclease 0.440 0.025 0.541 2e-08
UNIPROTKB|F1MCQ5 1920 DICER1 "Endoribonuclease Dicer 0.440 0.025 0.520 2.1e-08
UNIPROTKB|Q9UPY3 1922 DICER1 "Endoribonuclease Dicer 0.440 0.024 0.520 2.1e-08
TAIR|locus:2097705 DCL2 "dicer-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 152 (58.6 bits), Expect = 2.0e-09, P = 2.0e-09
 Identities = 26/43 (60%), Positives = 36/43 (83%)

Query:     9 FNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSK 51
             F RG+ NI+VAT +LEEG+D+QSCNLVI+FDP  +  S++QS+
Sbjct:   444 FRRGLVNIIVATSILEEGLDVQSCNLVIRFDPASNICSFIQSR 486
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0003725 "double-stranded RNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0004525 "ribonuclease III activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006396 "RNA processing" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0016891 "endoribonuclease activity, producing 5'-phosphomonoesters" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0010216 "maintenance of DNA methylation" evidence=IMP
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA;IMP
GO:0051607 "defense response to virus" evidence=RCA;IMP
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=IGI;RCA
GO:0000398 "mRNA splicing, via spliceosome" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0007267 "cell-cell signaling" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010050 "vegetative phase change" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0016569 "covalent chromatin modification" evidence=RCA
GO:0030422 "production of siRNA involved in RNA interference" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|F1NJX0 DICER1 "Endoribonuclease Dicer" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q25BN1 DICER1 "Endoribonuclease Dicer" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP11 DICER1 "Endoribonuclease Dicer" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00000939 dcr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|B3DLA6 dicer1 "Endoribonuclease Dicer" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|A0MQH0 DICER1 "Endoribonuclease Dicer" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
MGI|MGI:2177178 Dicer1 "dicer 1, ribonuclease type III" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCQ5 DICER1 "Endoribonuclease Dicer" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UPY3 DICER1 "Endoribonuclease Dicer" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3EBC8DCL2_ARATH3, ., 1, ., 2, 6, ., -0.59090.40360.0317yesN/A
Q8R418DICER_MOUSE3, ., 1, ., 2, 6, ., -0.53060.44950.0255yesN/A
A0MQH0DICER_CRIGR3, ., 1, ., 2, 6, ., -0.53060.44950.0255yesN/A
B3DLA6DICER_XENTR3, ., 1, ., 2, 6, ., -0.51020.44950.0258yesN/A
Q25BN1DICER_CHICK3, ., 1, ., 2, 6, ., -0.51020.44950.0255yesN/A
Q6TV19DICER_DANRE3, ., 1, ., 2, 6, ., -0.51020.44950.0262yesN/A
P34529DCR1_CAEEL3, ., 1, ., 2, 6, ., -0.63630.40360.0230yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-13
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-11
smart0049082 smart00490, HELICc, helicase superfamily c-termina 5e-11
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-08
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 2e-07
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 1e-06
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-06
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-05
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 4e-05
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 6e-05
TIGR00580 926 TIGR00580, mfd, transcription-repair coupling fact 2e-04
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 3e-04
COG1197 1139 COG1197, Mfd, Transcription-repair coupling factor 3e-04
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.002
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information 
 Score = 59.8 bits (146), Expect = 2e-13
 Identities = 20/46 (43%), Positives = 28/46 (60%)

Query: 4  QTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQ 49
          + +  F  G + +LVATDV   GID+   NLVI +D P +  SY+Q
Sbjct: 24 EILEDFRNGKSKVLVATDVAGRGIDLPDVNLVINYDLPWNPASYIQ 69

The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase. Length = 78
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG0331|consensus519 99.91
KOG0330|consensus476 99.89
KOG0335|consensus482 99.88
KOG0333|consensus673 99.88
KOG0336|consensus629 99.88
KOG0328|consensus400 99.88
KOG0345|consensus 567 99.87
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.87
PTZ00110545 helicase; Provisional 99.87
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.87
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.87
KOG0340|consensus442 99.86
KOG0341|consensus610 99.85
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.84
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.84
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.84
KOG0342|consensus543 99.84
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.83
KOG0338|consensus 691 99.83
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.83
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.82
KOG0344|consensus593 99.82
PTZ00424401 helicase 45; Provisional 99.81
KOG0326|consensus459 99.81
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.81
KOG0332|consensus477 99.81
KOG0350|consensus620 99.8
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.8
KOG0348|consensus 708 99.8
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.8
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.8
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.79
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.79
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.76
KOG0354|consensus 746 99.73
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.73
KOG0343|consensus 758 99.71
KOG0347|consensus 731 99.71
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.71
KOG0327|consensus397 99.7
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.7
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.7
PRK13767 876 ATP-dependent helicase; Provisional 99.68
KOG0346|consensus 569 99.67
PRK10689 1147 transcription-repair coupling factor; Provisional 99.66
KOG0334|consensus 997 99.66
PRK04914 956 ATP-dependent helicase HepA; Validated 99.66
PRK13766 773 Hef nuclease; Provisional 99.65
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.65
smart0049082 HELICc helicase superfamily c-terminal domain. 99.65
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.64
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.62
PHA02653 675 RNA helicase NPH-II; Provisional 99.62
PRK05298652 excinuclease ABC subunit B; Provisional 99.61
KOG4284|consensus 980 99.61
KOG0339|consensus 731 99.6
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.58
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.58
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.57
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.57
PRK02362 737 ski2-like helicase; Provisional 99.53
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.52
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.52
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.51
KOG0349|consensus725 99.49
PHA02558501 uvsW UvsW helicase; Provisional 99.47
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.46
KOG0351|consensus 941 99.46
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.42
KOG0352|consensus 641 99.41
PRK00254 720 ski2-like helicase; Provisional 99.4
PRK05580679 primosome assembly protein PriA; Validated 99.39
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.38
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.37
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.37
KOG0329|consensus387 99.37
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.35
PRK01172 674 ski2-like helicase; Provisional 99.34
KOG0337|consensus 529 99.34
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.33
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.32
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.29
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.28
PRK14701 1638 reverse gyrase; Provisional 99.19
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.19
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.13
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.12
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.1
PRK09401 1176 reverse gyrase; Reviewed 99.08
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 98.94
COG1205 851 Distinct helicase family with a unique C-terminal 98.92
PRK09694 878 helicase Cas3; Provisional 98.91
KOG0353|consensus 695 98.88
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.77
KOG4150|consensus 1034 98.77
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.64
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.63
COG1204 766 Superfamily II helicase [General function predicti 98.58
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.29
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.28
COG1202 830 Superfamily II helicase, archaea-specific [General 98.25
KOG0926|consensus 1172 98.15
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.12
KOG0949|consensus 1330 98.1
KOG0950|consensus 1008 98.1
KOG0953|consensus 700 98.03
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.03
KOG0920|consensus 924 97.97
KOG0947|consensus 1248 97.9
KOG0390|consensus776 97.87
KOG0922|consensus 674 97.87
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 97.81
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.77
KOG0384|consensus 1373 97.75
KOG0924|consensus 1042 97.73
KOG0385|consensus 971 97.73
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.71
KOG0923|consensus 902 97.71
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.61
PF13871 278 Helicase_C_4: Helicase_C-like 97.53
KOG0952|consensus 1230 97.5
KOG0951|consensus 1674 97.48
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.45
KOG0948|consensus 1041 97.44
KOG0387|consensus 923 97.44
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.4
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.37
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.34
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.31
KOG0701|consensus 1606 97.27
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.25
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.18
COG4889 1518 Predicted helicase [General function prediction on 97.11
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.1
KOG0392|consensus1549 97.06
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.03
PRK14873665 primosome assembly protein PriA; Provisional 96.91
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 96.9
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 96.69
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.69
KOG0389|consensus941 96.55
KOG0925|consensus 699 96.45
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.39
KOG1123|consensus776 96.26
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.22
KOG0388|consensus1185 95.99
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 95.85
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.73
CHL00122 870 secA preprotein translocase subunit SecA; Validate 95.35
KOG4439|consensus901 95.15
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 95.04
COG4096 875 HsdR Type I site-specific restriction-modification 95.03
KOG1513|consensus 1300 94.27
KOG0391|consensus 1958 94.09
KOG1000|consensus689 94.08
KOG1015|consensus 1567 93.52
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 93.24
KOG0386|consensus 1157 92.82
KOG1002|consensus791 91.95
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 88.86
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 88.44
KOG1016|consensus 1387 83.38
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 80.2
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 80.2
>KOG0331|consensus Back     alignment and domain information 
Probab=99.91  E-value=1.8e-24  Score=166.44  Aligned_cols=88  Identities=25%  Similarity=0.386  Sum_probs=74.7

Q ss_pred             ChHHHHHHHhcCCccEEEEcCccccccccCCCCEEEEeCCCCCHHHHHHHHhhcccCCCceEEEEeccCchHHHhhcchH
Q psy16582          1 MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSERYLQYNSPK   80 (109)
Q Consensus         1 er~~~~~~F~~g~~~iLV~T~~~~~Gldi~~v~~Vi~~d~p~~~~~y~qr~GR~gR~g~~~~~~~~~~~~~~~~~~~~~~   80 (109)
                      ||+.+|+.|++|++.||||||+++||||+|+|++|||||+|.++++|+||+||+||+|++|..+.|+...+..      .
T Consensus       379 eR~~~L~~FreG~~~vLVATdVAaRGLDi~dV~lVInydfP~~vEdYVHRiGRTGRa~~~G~A~tfft~~~~~------~  452 (519)
T KOG0331|consen  379 ERDWVLKGFREGKSPVLVATDVAARGLDVPDVDLVINYDFPNNVEDYVHRIGRTGRAGKKGTAITFFTSDNAK------L  452 (519)
T ss_pred             HHHHHHHhcccCCcceEEEcccccccCCCccccEEEeCCCCCCHHHHHhhcCccccCCCCceEEEEEeHHHHH------H
Confidence            5889999999999999999999999999999999999999999999999999999999988888875544333      3


Q ss_pred             HHHHHHHHhhcCcc
Q psy16582         81 INRLLQLLRRYNPD   94 (109)
Q Consensus        81 ~~~~~~~~~~~~~~   94 (109)
                      ...+.+.+++.++.
T Consensus       453 a~~l~~~l~e~~q~  466 (519)
T KOG0331|consen  453 ARELIKVLREAGQT  466 (519)
T ss_pred             HHHHHHHHHHccCC
Confidence            44555566555543

>KOG0330|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 4e-05
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 4e-05
2vso_A395 Crystal Structure Of A Translation Initiation Compl 5e-05
1fuu_A394 Yeast Initiation Factor 4a Length = 394 1e-04
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 1e-04
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-04
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-04
4i1s_A243 Melanoma Differentiation Associated Protein-5 Helic 2e-04
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 2e-04
4gl2_A 699 Structural Basis For Dsrna Duplex Backbone Recognit 3e-04
3tbk_A555 Mouse Rig-I Atpase Domain Length = 555 4e-04
3tmi_A 695 Structural Basis For Rna Recognition And Activation 8e-04
4ay2_A 687 Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I 8e-04
2ykg_A 696 Structural Insights Into Rna Recognition By Rig-I L 8e-04
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure 
Iteration: 1

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 26/44 (59%)
Query: 6   MLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQ 49
           M  F RG    LVATDV   GIDI++ +LVI +D P    SYV 
Sbjct: 78  MNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVH 121
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|4I1S|A Chain A, Melanoma Differentiation Associated Protein-5 Helicase Domain Complex With Inhibitor Non-structural Protein V Length = 243 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 Back     alignment and structure
>pdb|3TBK|A Chain A, Mouse Rig-I Atpase Domain Length = 555 Back     alignment and structure
>pdb|3TMI|A Chain A, Structural Basis For Rna Recognition And Activation Of Rig-I Length = 695 Back     alignment and structure
>pdb|4AY2|A Chain A, Capturing 5' Tri-Phosphorylated Rna Duplex By Rig-I Length = 687 Back     alignment and structure
>pdb|2YKG|A Chain A, Structural Insights Into Rna Recognition By Rig-I Length = 696 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-14
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-14
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-13
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 3e-13
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-13
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 1e-11
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 9e-11
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-10
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-10
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-10
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-10
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 3e-10
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 5e-10
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-09
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-09
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-09
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 4e-09
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 5e-09
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 7e-09
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 8e-09
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-08
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 2e-08
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-08
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-08
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 2e-08
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 3e-08
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 4e-08
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 4e-08
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 8e-08
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 2e-07
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 7e-05
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 3e-04
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
 Score = 66.7 bits (162), Expect = 2e-14
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 4   QTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSK 51
             +  F RG  N+LVAT V EEG+D+   +LV+ ++P       +Q +
Sbjct: 410 LILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRR 457
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Length = 1151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.88
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.87
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.87
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.87
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.86
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.86
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.86
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.84
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.84
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.72
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.82
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.81
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.81
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.8
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.8
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.8
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.79
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.79
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.79
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.79
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.78
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.78
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.78
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.77
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.77
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.76
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.76
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.74
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.74
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.73
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.73
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.73
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.73
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.72
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.71
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.71
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.7
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.69
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.69
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.69
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.69
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.67
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.66
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.65
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.64
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.63
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.62
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.62
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.62
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.61
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.61
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.61
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.61
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.6
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.6
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.6
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.6
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.59
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.57
3h1t_A590 Type I site-specific restriction-modification syst 99.55
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.54
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.51
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.5
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.49
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.47
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.41
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.33
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.31
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.3
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.25
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.13
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 96.53
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.36
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.94
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 90.39
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
Probab=99.88  E-value=1.9e-22  Score=139.49  Aligned_cols=71  Identities=25%  Similarity=0.431  Sum_probs=64.6

Q ss_pred             ChHHHHHHHhcCCccEEEEcCccccccccCCCCEEEEeCCCCCHHHHHHHHhhcccCCCceEEEEeccCch
Q psy16582          1 MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSE   71 (109)
Q Consensus         1 er~~~~~~F~~g~~~iLV~T~~~~~Gldi~~v~~Vi~~d~p~~~~~y~qr~GR~gR~g~~~~~~~~~~~~~   71 (109)
                      +|++++++|++|+++|||||+++++|+|+|++++||+||+|++..+|+||+||+||.|+.|.++.++...+
T Consensus        69 ~r~~~~~~f~~g~~~vlvaT~~~~~Gidi~~v~~Vi~~~~p~~~~~~~qr~GR~gR~g~~g~~~~l~~~~~  139 (212)
T 3eaq_A           69 ERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTGRAGRGGRVVLLYGPRE  139 (212)
T ss_dssp             HHHHHHHHHHSSSCCEEEECTTTTCSSSCCCBSEEEESSCCSSHHHHHHHHTTBCCCC--BEEEEEECGGG
T ss_pred             HHHHHHHHHHCCCCeEEEecChhhcCCCCccCcEEEECCCCcCHHHHHHHhcccCCCCCCCeEEEEEchhH
Confidence            47889999999999999999999999999999999999999999999999999999998888888876544
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 8e-08
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 1e-05
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 8e-05
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]

 Score = 46.4 bits (109), Expect = 8e-08
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 4   QTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQ 49
             +  F RG  N+LVAT V EEG+D+   +LV+ ++P       +Q
Sbjct: 210 LILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQ 255
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.92
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.91
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.9
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.9
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.9
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.9
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.89
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.87
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.87
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.85
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.82
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.78
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.71
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.71
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.69
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.65
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.54
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.27
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.1
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.03
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.99
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.48
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.17
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 89.74
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 83.96
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.92  E-value=1.3e-25  Score=149.73  Aligned_cols=72  Identities=19%  Similarity=0.369  Sum_probs=67.0

Q ss_pred             ChHHHHHHHhcCCccEEEEcCccccccccCCCCEEEEeCCCCCHHHHHHHHhhcccCCCceEEEEeccCchH
Q psy16582          1 MDVQTMLSFNRGITNILVATDVLEEGIDIQSCNLVIKFDPPQHTRSYVQSKAFTVVRHKAEQILSQYPKSER   72 (109)
Q Consensus         1 er~~~~~~F~~g~~~iLV~T~~~~~Gldi~~v~~Vi~~d~p~~~~~y~qr~GR~gR~g~~~~~~~~~~~~~~   72 (109)
                      +|.+++++|++|++++|||||+++||+|+|+|++|||||+|++..+|+||+||+||.|+.|.++.++.+.+.
T Consensus        72 ~r~~~~~~fk~g~~~iLv~Td~~~rGiDi~~v~~VIn~d~P~~~~~yihR~GR~gR~g~~G~~i~~~~~~d~  143 (168)
T d2j0sa2          72 ERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDI  143 (168)
T ss_dssp             HHHHHHHHHHHTSSCEEEECGGGSSSCCCTTEEEEEESSCCSSHHHHHHHHTTSSGGGCCEEEEEEEEGGGH
T ss_pred             HHHHHHHHHhcCCccEEeccchhcccccccCcceEEEecCCcCHHHHHhhhccccccCCCcEEEEEECHHHH
Confidence            478899999999999999999999999999999999999999999999999999999999999888655544
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure