Psyllid ID: psy16583

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------
MSTPGSAPTATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAANDQQPISTSVMSTPGSAPTATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTAPALTSRPRTESGRPVSGVVRPGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSVIP
cccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHcccHHHHcccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccHHccHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEccccccHcHHHHHHHccccEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccEEcccccccccHHHHHHcHccHccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHcccccccccccccEcccccEEEEccccHcccccccEEEHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccc
mstpgsaptatvDSMFYAVDHFHKRNFEKCAAICTELlaknpydkaAWTLKMRsltsqlsvddleaeeegiadsvldtntiataarpgtslktaandqqpistsvmstpgsaptatvDSMFYAVDHFHKRNFEKCAAICTELlaknpydkaAWTLKMRsltsqlsvddleaeeegiadsvldtntiataarpgtslktaavtapaltsrprtesgrpvsgvvrpgtlasrggtleqslktprtaksarpltSQAARTIRLGTasmlsqpdgpfiqvSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVEStkacefrdwwwkvqlgkcyFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRldqpiraidigrnaldcypnevTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGvnhfyndqPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIitecspfsfsthTSYLFIQGISDTRLAIQCLHLALSidsshglsqnNLAVLEAREGHIERASTYLQAAaasspylyetHYNQAVISNLVSVIP
mstpgsaptatvDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGiadsvldtnTIATaarpgtslktaandqqpistsvmstpgsAPTATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGiadsvldtntiataarpgtslktaavtapaltsrprtesgrpvsgvvrpgtlasrggtleqslktprtaksarpltsqAARTIRLGTasmlsqpdgpfIQVSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSVIP
MSTPGSAPTATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAANDQQPISTSVMSTPGSAPTATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTAPALTSRPRTESGRPVSGVVRPGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSVIP
***********VDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLT***********************************************************TVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLT**************************************************************************************************************PFIQVSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSV**
************DSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSL**************************DSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAAR***********************GRPVSGVV*********************AKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSVIP
*********ATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAANDQQ*************PTATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTAP**************SGVVRPGTLASR*********************SQAARTIRLGTASMLSQPDGPFIQVSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSVIP
**********TVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARP****************************TVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATA**************************RPVS*VV*PGT*********************RPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSVIP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTPGSAPTATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAANDQQPISTSVMSTPGSAPTATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEEGIADSVLDTNTIATAARPGTSLKTAAVTAPALTSRPRTESGRPVSGVVRPGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKYARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSVIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query677 2.2.26 [Sep-21-2011]
Q8VD72515 Tetratricopeptide repeat yes N/A 0.654 0.860 0.498 1e-135
Q8TAM2541 Tetratricopeptide repeat no N/A 0.580 0.726 0.505 1e-133
Q96RK4519 Bardet-Biedl syndrome 4 p no N/A 0.345 0.450 0.252 4e-06
Q96301 914 Probable UDP-N-acetylgluc yes N/A 0.369 0.273 0.221 9e-06
O82422 944 Probable UDP-N-acetylgluc N/A N/A 0.369 0.264 0.217 3e-05
Q1JQ97519 Bardet-Biedl syndrome 4 p no N/A 0.339 0.443 0.249 4e-05
A1Z8E9486 Bardet-Biedl syndrome 4 p no N/A 0.326 0.454 0.222 4e-05
Q8RVB2 931 Probable UDP-N-acetylgluc N/A N/A 0.369 0.268 0.214 8e-05
Q8C1Z7520 Bardet-Biedl syndrome 4 p no N/A 0.345 0.45 0.252 0.0002
Q6YZI0 927 Probable UDP-N-acetylgluc yes N/A 0.369 0.269 0.217 0.0004
>sp|Q8VD72|TTC8_MOUSE Tetratricopeptide repeat protein 8 OS=Mus musculus GN=Ttc8 PE=2 SV=1 Back     alignment and function desciption
 Score =  483 bits (1244), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/465 (49%), Positives = 321/465 (69%), Gaps = 22/465 (4%)

Query: 117 VDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDK----------AAWTLKMRSLTSQLSV 166
           ++ +  A  +F +R F+ CA +CT++L K+PYD+          AAW LK R+LT  + +
Sbjct: 5   MEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYI 64

Query: 167 DDLEAEEEGIADSVLDTNTIATAARPGTSLK---TAAVTAPALTSRPRTESGRPVSGVVR 223
           D+++ ++EGIA+ +LD N IA   RPGTSLK   T     P    RP T++GRP++G +R
Sbjct: 65  DEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLR 124

Query: 224 PGTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAK 283
           P T + R GT+EQ+++TPRTA +ARP+TS + R +RLGTASML+ PDGPFI +SRLNL K
Sbjct: 125 PSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTK 184

Query: 284 YARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREA 343
           Y++   +AK LFEY+ HHENDV  A+DLA  ST+  +++DWWWKVQ+GKCY+ LG+ REA
Sbjct: 185 YSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREA 244

Query: 344 QQQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEG 403
           ++QF SAL Q   ++ F+ + +VYI LDQP+ A+++ +  LD +P EVT++  +ARI+E 
Sbjct: 245 EKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEE 304

Query: 404 LNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFN 463
           +NN   + +YYK +LK+D T +EAIACIG NHFY+DQPEVAL FYRRLLQMG+YN +LFN
Sbjct: 305 MNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFN 364

Query: 464 NLALCCFYSQQYDMVVTCFERALSLALN-ENAADVWYNISHVAILNALSTSVYNDQPEVA 522
           NL LCCFY+QQYDM +T FERALSLA N E AADVWYN+ H+A+    +         +A
Sbjct: 365 NLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTN--------LA 416

Query: 523 LLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLA 567
              +R  L    ++AE +NNLA+        +      + A SLA
Sbjct: 417 HQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLA 461
The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This ciliogenic function is mediated in part by the Rab8 GDP/GTP exchange factor, which localizes to the basal body and contacts the BBSome. Rab8(GTP) enters the primary cilium and promotes extension of the ciliary membrane. Firstly the BBSome associates with the ciliary membrane and binds to RAB3IP/Rabin8, the guanosyl exchange factor (GEF) for Rab8 and then the Rab8-GTP localizes to the cilium and promotes docking and fusion of carrier vesicles to the base of the ciliary membrane.
Mus musculus (taxid: 10090)
>sp|Q8TAM2|TTC8_HUMAN Tetratricopeptide repeat protein 8 OS=Homo sapiens GN=TTC8 PE=1 SV=2 Back     alignment and function description
>sp|Q96RK4|BBS4_HUMAN Bardet-Biedl syndrome 4 protein OS=Homo sapiens GN=BBS4 PE=1 SV=2 Back     alignment and function description
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q1JQ97|BBS4_BOVIN Bardet-Biedl syndrome 4 protein homolog OS=Bos taurus GN=BBS4 PE=2 SV=1 Back     alignment and function description
>sp|A1Z8E9|BBS4_DROME Bardet-Biedl syndrome 4 protein homolog OS=Drosophila melanogaster GN=BBS4 PE=3 SV=1 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q8C1Z7|BBS4_MOUSE Bardet-Biedl syndrome 4 protein homolog OS=Mus musculus GN=Bbs4 PE=2 SV=1 Back     alignment and function description
>sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
328699792503 PREDICTED: tetratricopeptide repeat prot 0.574 0.773 0.625 1e-149
156546020498 PREDICTED: tetratricopeptide repeat prot 0.571 0.777 0.593 1e-147
350417804496 PREDICTED: tetratricopeptide repeat prot 0.543 0.741 0.612 1e-145
340729289764 PREDICTED: tetratricopeptide repeat prot 0.543 0.481 0.612 1e-145
307197616496 Tetratricopeptide repeat protein 8 [Harp 0.571 0.780 0.609 1e-145
332030272496 Tetratricopeptide repeat protein 8 [Acro 0.571 0.780 0.609 1e-145
156546022508 PREDICTED: tetratricopeptide repeat prot 0.571 0.761 0.578 1e-144
380017154496 PREDICTED: tetratricopeptide repeat prot 0.543 0.741 0.594 1e-143
383855556496 PREDICTED: tetratricopeptide repeat prot 0.571 0.780 0.607 1e-143
443692485499 hypothetical protein CAPTEDRAFT_163723 [ 0.654 0.887 0.512 1e-143
>gi|328699792|ref|XP_001944378.2| PREDICTED: tetratricopeptide repeat protein 8-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  534 bits (1375), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 245/392 (62%), Positives = 312/392 (79%), Gaps = 3/392 (0%)

Query: 115 ATVDSMFYAVDHFHKRNFEKCAAICTELLAKNPYDKAAWTLKMRSLTSQLSVDDLEAEEE 174
           A++D+ + A     K N++KC   CT +L+KNPYD+AAW LKMR+LT QLS+DD+EAEEE
Sbjct: 8   ASLDTFYSACMDLRKHNYDKCIESCTIILSKNPYDQAAWALKMRALTEQLSIDDIEAEEE 67

Query: 175 GIADSVLDTNTIATAARPGTSLKTAAVTAPALTSRPRTESGRPVSGVVRPGTLASRGGTL 234
           GIADS  +++ IA  AR GTSL+TA  T+     RPRT  GRP+SG+VRP T ++ G  L
Sbjct: 68  GIADSYFNSDAIAENARVGTSLRTAQDTS---NQRPRTVGGRPLSGIVRPSTSSAGGNNL 124

Query: 235 EQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKYARDKTVAKYL 294
           + +LKTPRT  S+RPLTSQ+AR IRLGTASM+SQ DGPFI +SRLN  KYA DK ++K L
Sbjct: 125 QMALKTPRTVGSSRPLTSQSARNIRLGTASMVSQIDGPFINISRLNFPKYASDKQLSKLL 184

Query: 295 FEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQF 354
           F Y+Y+ +ND+ +A+D AVE+TK C F D WWKVQLGKCY  LGL+R+ + QF SAL   
Sbjct: 185 FNYIYYQQNDIRNALDFAVEATKCCNFEDPWWKVQLGKCYVMLGLLRDGEAQFRSALQHG 244

Query: 355 TDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYY 414
            +IE F+R+ R++IRLDQP+ ++DI + A+  +P+E+T++ EMARIFEGLNN+PMSVKYY
Sbjct: 245 PNIEVFLRLSRLFIRLDQPLSSLDICQKAMSWFPHEITLLIEMARIFEGLNNIPMSVKYY 304

Query: 415 KLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQ 474
           + IL+ DAT ME+IACIG++HFY+DQPEVAL +YRRLLQMGLYNAELFNNL LC FY+QQ
Sbjct: 305 RDILELDATDMESIACIGLHHFYSDQPEVALRYYRRLLQMGLYNAELFNNLGLCSFYAQQ 364

Query: 475 YDMVVTCFERALSLALNENAADVWYNISHVAI 506
           +D+V  CFE AL LAL++NAADVWYNISHVAI
Sbjct: 365 FDVVTACFENALRLALDDNAADVWYNISHVAI 396

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156546020|ref|XP_001608003.1| PREDICTED: tetratricopeptide repeat protein 8-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350417804|ref|XP_003491603.1| PREDICTED: tetratricopeptide repeat protein 8-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729289|ref|XP_003402937.1| PREDICTED: tetratricopeptide repeat protein 8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307197616|gb|EFN78804.1| Tetratricopeptide repeat protein 8 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332030272|gb|EGI70046.1| Tetratricopeptide repeat protein 8 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156546022|ref|XP_001608007.1| PREDICTED: tetratricopeptide repeat protein 8-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380017154|ref|XP_003692527.1| PREDICTED: tetratricopeptide repeat protein 8-like [Apis florea] Back     alignment and taxonomy information
>gi|383855556|ref|XP_003703276.1| PREDICTED: tetratricopeptide repeat protein 8-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|443692485|gb|ELT94078.1| hypothetical protein CAPTEDRAFT_163723 [Capitella teleta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query677
UNIPROTKB|E1C4G5515 TTC8 "Uncharacterized protein" 0.618 0.813 0.512 4.2e-132
UNIPROTKB|F1N4X0506 TTC8 "Uncharacterized protein" 0.661 0.885 0.521 1.1e-126
UNIPROTKB|F1SDY6506 TTC8 "Uncharacterized protein" 0.654 0.875 0.519 2.9e-126
ZFIN|ZDB-GENE-030131-8846507 ttc8 "tetratricopeptide repeat 0.658 0.879 0.508 1.7e-123
RGD|1307769515 Ttc8 "tetratricopeptide repeat 0.654 0.860 0.503 3.1e-122
MGI|MGI:1923510515 Ttc8 "tetratricopeptide repeat 0.654 0.860 0.498 2.2e-121
UNIPROTKB|Q8TAM2541 TTC8 "Tetratricopeptide repeat 0.516 0.646 0.426 3e-89
UNIPROTKB|E2REN6540 TTC8 "Uncharacterized protein" 0.571 0.716 0.390 1.7e-86
WB|WBGene00000244506 bbs-8 [Caenorhabditis elegans 0.559 0.749 0.431 1.1e-95
UNIPROTKB|Q23049506 bbs-8 "Protein BBS-8" [Caenorh 0.559 0.749 0.431 1.1e-95
UNIPROTKB|E1C4G5 TTC8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1155 (411.6 bits), Expect = 4.2e-132, Sum P(2) = 4.2e-132
 Identities = 227/443 (51%), Positives = 317/443 (71%)

Query:   118 DSMFYAVDHFHKRNFEKCAAICTELLAKNP--------YD--KAAWTLKMRSLTSQLSVD 167
             + +F A  +F +R F +C+ +C++LL   P        Y   +AAW+LK R+LT  + VD
Sbjct:     6 EPLFQAWSYFRRRKFRQCSELCSQLLEGAPGEQENDTGYSAFQAAWSLKTRALTEMVYVD 65

Query:   168 DLEAEEEGIADSVLDTNTIATAARPGTSLK---TAAVTAPALTSRPRTESGRPVSGVVRP 224
             ++E ++EGIA+ +LD N IA  ARPGTSLK   T+    P+   RP T+SGRP++G VRP
Sbjct:    66 EIEIDQEGIAEMMLDENAIAQVARPGTSLKLPGTSQGGGPSPAVRPITQSGRPITGFVRP 125

Query:   225 GTLASRGGTLEQSLKTPRTAKSARPLTSQAARTIRLGTASMLSQPDGPFIQVSRLNLAKY 284
              T + R  T+EQ++KTPRTA +ARP++S + R +RLGTASM++ PDGPFI VSRLNL+KY
Sbjct:   126 STQSGRPSTMEQAIKTPRTALTARPISSASGRYVRLGTASMITNPDGPFINVSRLNLSKY 185

Query:   285 ARDKTVAKYLFEYLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQ 344
             A+   +AK LFEY++HHENDV +A+DLA  +T+  +F+DWWWKVQ+GKC++ LGL REA+
Sbjct:   186 AQKPELAKALFEYIFHHENDVKNALDLAALATEHAQFKDWWWKVQIGKCFYRLGLYREAE 245

Query:   345 QQFNSALNQFTDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGL 404
             +QF SAL Q   ++  + + +VY+RLDQP+ A+++ +  L+ +P EVT++  +ARI+E +
Sbjct:   246 KQFKSALKQQDMVDTILYLAKVYLRLDQPVTALNLFKQGLERFPGEVTLICGIARIYEEM 305

Query:   405 NNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNN 464
             N++  + +YYK +LK+D T +EAIACIG N FY+DQPE+AL FYRRLLQMG+YN +LFNN
Sbjct:   306 NDISSAAEYYKEVLKQDNTHVEAIACIGSNRFYSDQPEIALRFYRRLLQMGVYNYQLFNN 365

Query:   465 LALCCFYSQQYDMVVTCFERALSLALNENA-ADVWYNISHVAI-LNALSTSVYNDQPEVA 522
             L LCCFY+QQYDM +T FERAL LA NE   ADVWYN+ HVA+ +  L+ + Y       
Sbjct:   366 LGLCCFYAQQYDMTLTSFERALFLAENEEERADVWYNLGHVAVGIGDLNLA-YQ------ 418

Query:   523 LLFYRRLLQMGLYNAELFNNLAL 545
               F   L+    Y AE +NNLA+
Sbjct:   419 -CFKLTLVNNNDY-AEAYNNLAV 439
GO:0005813 "centrosome" evidence=IEA
GO:0005932 "microtubule basal body" evidence=IEA
GO:0032391 "photoreceptor connecting cilium" evidence=IEA
GO:0034464 "BBSome" evidence=IEA
GO:0044441 "cilium part" evidence=IEA
GO:0045444 "fat cell differentiation" evidence=IEA
GO:0048560 "establishment of anatomical structure orientation" evidence=IEA
UNIPROTKB|F1N4X0 TTC8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDY6 TTC8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8846 ttc8 "tetratricopeptide repeat domain 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1307769 Ttc8 "tetratricopeptide repeat domain 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1923510 Ttc8 "tetratricopeptide repeat domain 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TAM2 TTC8 "Tetratricopeptide repeat protein 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2REN6 TTC8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00000244 bbs-8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q23049 bbs-8 "Protein BBS-8" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VD72TTC8_MOUSENo assigned EC number0.49890.65430.8601yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-10
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 9e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information 
 Score = 56.6 bits (137), Expect = 4e-10
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 10/107 (9%)

Query: 460 ELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQP 519
           E   NL    +    YD  +  +E+AL L  + + AD +YN++               + 
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYYEKALEL--DPDNADAYYNLAAAYY--------KLGKY 50

Query: 520 EVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSL 566
           E AL  Y + L++   NA+ + NL L  +   +Y+  +  +E+AL L
Sbjct: 51  EEALEDYEKALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALEL 97

Length = 100
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-04
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 12/123 (9%)
Query: 459 AELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQ 518
           AE + NL    +    YD  +  +++AL L  +  +A+ WYN+      NA       D+
Sbjct: 1   AEAWYNLGNAYYKQGDYDEAIEYYQKALEL--DPRSAEAWYNLG-----NAYYKQGDYDE 53
Query: 519 PEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYN 578
              A+ +Y++ L++   +AE + NL    +    YD  +  +++AL   L+  +A+ WYN
Sbjct: 54  ---AIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALE--LDPRSAEAWYN 108
Query: 579 ISH 581
           + +
Sbjct: 109 LGN 111
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query677
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-24
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-23
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-09
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-23
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-20
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-20
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-21
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-18
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 8e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-19
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-16
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-13
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-18
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-17
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-14
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-17
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-08
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-17
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-14
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-08
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-17
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-15
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-11
4g1t_A 472 Interferon-induced protein with tetratricopeptide 1e-09
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 9e-16
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-07
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 6e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-15
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-15
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-14
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-14
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-14
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-11
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 2e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 9e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-14
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-09
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-14
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-13
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-12
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-13
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-06
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-12
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-08
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-12
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 6e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-11
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-11
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-10
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-10
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-10
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-09
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-10
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 9e-10
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 4e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 7e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-09
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 8e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-06
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 3e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score =  104 bits (262), Expect = 3e-24
 Identities = 70/341 (20%), Positives = 128/341 (37%), Gaps = 32/341 (9%)

Query: 330 LGKCYFSLGLIREAQQQFNSALNQF-TDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYP 388
           L   +F    +  +      A+ Q     EA+  +  VY    Q   AI+  R+AL   P
Sbjct: 39  LSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP 98

Query: 389 NEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFY 448
           + +     +A       +M  +V+ Y   L+ +       + +G       + E A   Y
Sbjct: 99  DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY 158

Query: 449 RRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILN 508
            + ++     A  ++NL        +  + +  FE+A+   L+ N  D + N+    +L 
Sbjct: 159 LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAV--TLDPNFLDAYINLG--NVLK 214

Query: 509 ALSTSVYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLAL 568
                      + A+  Y R L +   +A +  NLA   +     D+ +  + RA+   L
Sbjct: 215 EA------RIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAI--EL 266

Query: 569 NENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLS 628
             +  D + N+++                  L  +G      A  C + AL +  +H  S
Sbjct: 267 QPHFPDAYCNLANA-----------------LKEKG--SVAEAEDCYNTALRLCPTHADS 307

Query: 629 QNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVI 669
            NNLA ++  +G+IE A    + A    P     H N A +
Sbjct: 308 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASV 348
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query677
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.98
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.96
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.94
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.93
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.92
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.92
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.91
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.91
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.9
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.9
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.9
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.9
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.89
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.89
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.89
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.88
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.88
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.88
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.88
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.87
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.86
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.86
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.85
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.85
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.84
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.84
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.83
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.83
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.82
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.82
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.82
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.81
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.78
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.77
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.77
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.77
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.76
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.76
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.75
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.74
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.73
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.73
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.71
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.71
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.71
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.69
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.68
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.67
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.66
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.66
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.65
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.65
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.65
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.64
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.64
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.63
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.6
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.6
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.59
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.59
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.58
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.57
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.57
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.56
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.55
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.54
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.54
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.53
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.53
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.53
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.52
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.51
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.51
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.5
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.5
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.48
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.48
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.47
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.47
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.47
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.46
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.46
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.45
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.45
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.44
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.44
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.44
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.43
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.42
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.42
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.41
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.4
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.4
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.4
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.39
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.38
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.38
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.37
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.36
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.36
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.36
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.35
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.32
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.32
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.32
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.31
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.31
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.3
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.3
3k9i_A117 BH0479 protein; putative protein binding protein, 99.29
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.29
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.28
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.27
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.26
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 99.26
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.26
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.25
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.25
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.24
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.21
3k9i_A117 BH0479 protein; putative protein binding protein, 99.21
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.2
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.17
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.07
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.0
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.99
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.98
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.94
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.93
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.89
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.81
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.8
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.75
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.75
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.71
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.7
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.69
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.65
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.63
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.57
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.57
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.47
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.45
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.42
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.37
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.28
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.27
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.2
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.13
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.06
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.05
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.83
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.81
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.75
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.67
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.2
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.15
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.92
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.83
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.77
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.74
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.68
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.46
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.38
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 96.23
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.01
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.97
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.78
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.84
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.82
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 94.76
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.74
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.57
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.3
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 94.29
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.05
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 93.91
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.6
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 93.34
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.32
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.94
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.88
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.84
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.83
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.81
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 92.53
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 91.95
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.17
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 90.21
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.2
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 88.73
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=2.2e-41  Score=356.37  Aligned_cols=345  Identities=17%  Similarity=0.192  Sum_probs=332.3

Q ss_pred             HhcccCHHHHHHHHHHHHhhCcCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHccCC-CHHHHHHHHHHHHHcCChHHHH
Q psy16583        299 YHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFT-DIEAFIRMIRVYIRLDQPIRAI  377 (677)
Q Consensus       299 ~~~~g~~~~A~~~~~~a~~~~p~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p-~~~~~~~la~~~~~~g~~~~A~  377 (677)
                      +...|++++|+..++.+++..|. ....+..+|.++...|++++|+..|+++++..| +..++..+|.++...|++++|+
T Consensus        43 ~~~~~~~~~a~~~~~~a~~~~p~-~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~  121 (388)
T 1w3b_A           43 HFQCRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAV  121 (388)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHH
T ss_pred             HHHcCCHHHHHHHHHHHHhcCCC-chHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHH
Confidence            34468888999999999999854 455558999999999999999999999999999 8899999999999999999999


Q ss_pred             HHHHHHHHcCCCcHHHHHHHHHHHHHcCChhHHHHHHHHHHHhCcCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCC
Q psy16583        378 DIGRNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLY  457 (677)
Q Consensus       378 ~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~  457 (677)
                      ..|+++++.+|++..++..+|.++...|++++|+..|+++++.+|++..++..+|.++...|++++|+..|+++++.+|.
T Consensus       122 ~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~  201 (388)
T 1w3b_A          122 QAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN  201 (388)
T ss_dssp             HHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHhCCCcHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhhcccchHHHHHHHHHHHHHhhhcccccCCCHHHHHHHHHHHHHcCCCcH
Q psy16583        458 NAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNA  537 (677)
Q Consensus       458 ~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~l~~~~~l~~l~~~~~~~~~~~A~~~~~~al~~~p~~~  537 (677)
                      +..++..+|.++...|++++|+..|++++..+|++  ..++..+|.++.        ..|++++|+..|+++++.+|.++
T Consensus       202 ~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~--~~~~~~l~~~~~--------~~g~~~~A~~~~~~al~~~p~~~  271 (388)
T 1w3b_A          202 FLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH--AVVHGNLACVYY--------EQGLIDLAIDTYRRAIELQPHFP  271 (388)
T ss_dssp             CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTC--HHHHHHHHHHHH--------HTTCHHHHHHHHHHHHHTCSSCH
T ss_pred             cHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcCC--HHHHHHHHHHHH--------HcCCHHHHHHHHHHHHhhCCCCH
Confidence            99999999999999999999999999999999998  999999999998        99999999999999999999999


Q ss_pred             HHHHHHHHHHHhccCHHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHhhcCCCCcccchhhhHHhcCCCHHHHHHHHHH
Q psy16583        538 ELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHL  617 (677)
Q Consensus       538 ~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~p~~~~~~~~l~~~~~~~~~~p~~~~~~~~~~~l~~~g~~~~A~~~~~~  617 (677)
                      .++..+|.++...|++++|+.+|+++++  ..|.+..++..++.++.                   ..|++++|+..|++
T Consensus       272 ~~~~~l~~~~~~~g~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~-------------------~~g~~~~A~~~~~~  330 (388)
T 1w3b_A          272 DAYCNLANALKEKGSVAEAEDCYNTALR--LCPTHADSLNNLANIKR-------------------EQGNIEEAVRLYRK  330 (388)
T ss_dssp             HHHHHHHHHHHHHSCHHHHHHHHHHHHH--HCTTCHHHHHHHHHHHH-------------------TTTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHh--hCcccHHHHHHHHHHHH-------------------HcCCHHHHHHHHHH
Confidence            9999999999999999999999999999  88999999999999999                   99999999999999


Q ss_pred             HHccCCCChHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhcCC
Q psy16583        618 ALSIDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSV  675 (677)
Q Consensus       618 al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~G~  675 (677)
                      +++..|++..++..+|.++...|++++|+..|+++++++|++..+++++|.++..+|+
T Consensus       331 al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          331 ALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHhHHHHHHHccC
Confidence            9999999999999999999999999999999999999999999999999999998875
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 677
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-22
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-04
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 9e-09
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-08
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-08
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-07
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 8e-08
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 9e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-07
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 0.002
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.001
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 0.004
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 98.6 bits (244), Expect = 1e-22
 Identities = 66/394 (16%), Positives = 140/394 (35%), Gaps = 31/394 (7%)

Query: 294 LFE--YLYHHENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSAL 351
             E  +  +   D  +A    ++  +          + L   +F    +  +      A+
Sbjct: 2   PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVL-LLLSSIHFQCRRLDRSAHFSTLAI 60

Query: 352 NQF-TDIEAFIRMIRVYIRLDQPIRAIDIGRNALDCYPNEVTIMTEMARIFEGLNNMPMS 410
            Q     EA+  +  VY    Q   AI+  R+AL   P+ +     +A       +M  +
Sbjct: 61  KQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGA 120

Query: 411 VKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAELFNNLALCCF 470
           V+ Y   L+ +       + +G       + E A   Y + ++     A  ++NL     
Sbjct: 121 VQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFN 180

Query: 471 YSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLL 530
              +  + +  FE+A+   L+ N  D + N+ +V               + A+  Y R L
Sbjct: 181 AQGEIWLAIHHFEKAV--TLDPNFLDAYINLGNVLK--------EARIFDRAVAAYLRAL 230

Query: 531 QMGLYNAELFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHV-------- 582
            +   +A +  NLA   +     D+ +  + RA+   L  +  D + N+++         
Sbjct: 231 SLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAI--ELQPHFPDAYCNLANALKEKGSVA 288

Query: 583 -------AIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALSIDSSHGLSQNNLAVL 635
                    +  C   + S +      +   +   A++    AL +      + +NLA +
Sbjct: 289 EAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASV 348

Query: 636 EAREGHIERASTYLQAAAASSPYLYETHYNQAVI 669
             ++G ++ A  + + A   SP   + + N    
Sbjct: 349 LQQQGKLQEALMHYKEAIRISPTFADAYSNMGNT 382
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query677
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.9
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.89
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.84
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.83
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.8
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.79
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.61
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.58
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.58
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.54
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.46
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.46
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.45
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.38
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.37
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.37
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.37
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.36
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.36
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.36
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.35
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.32
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.32
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.31
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.29
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.29
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.26
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.24
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.04
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.96
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.93
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.82
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.81
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.75
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.61
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.61
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.03
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.0
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.93
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.86
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.1
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.01
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.75
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.61
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.2e-36  Score=316.06  Aligned_cols=342  Identities=18%  Similarity=0.195  Sum_probs=292.8

Q ss_pred             ccCHHHHHHHHHHHHhhCcCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHccCC-CHHHHHHHHHHHHHcCChHHHHHHH
Q psy16583        302 ENDVASAMDLAVESTKACEFRDWWWKVQLGKCYFSLGLIREAQQQFNSALNQFT-DIEAFIRMIRVYIRLDQPIRAIDIG  380 (677)
Q Consensus       302 ~g~~~~A~~~~~~a~~~~p~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p-~~~~~~~la~~~~~~g~~~~A~~~~  380 (677)
                      .|++++|+..|+++++.+|. ....+..+|.++...|++++|+..+..+....+ ...............+....+....
T Consensus        46 ~~~~~~A~~~~~~al~~~p~-~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  124 (388)
T d1w3ba_          46 CRRLDRSAHFSTLAIKQNPL-LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAY  124 (388)
T ss_dssp             TTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHH
T ss_pred             cCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHhhhhcccccccccccccccccccccccccccccccccccccccccccc
Confidence            45555555666666555533 233335556666666666666666666555555 4555555555555555555555555


Q ss_pred             HHHHHcCCCcHHHHHHHHHHHHHcCChhHHHHHHHHHHHhCcCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCHH
Q psy16583        381 RNALDCYPNEVTIMTEMARIFEGLNNMPMSVKYYKLILKRDATCMEAIACIGVNHFYNDQPEVALLFYRRLLQMGLYNAE  460 (677)
Q Consensus       381 ~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~  460 (677)
                      .......+.........+......+....+...+.+.+...|++..++..+|..+...|++++|...++++++.+|+++.
T Consensus       125 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~  204 (388)
T d1w3ba_         125 VSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD  204 (388)
T ss_dssp             HHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHH
T ss_pred             ccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHH
Confidence            55555555555566677777777888888999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHhhhcccchHHHHHHHHHHHHHhhhcccccCCCHHHHHHHHHHHHHcCCCcHHHH
Q psy16583        461 LFNNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAILNALSTSVYNDQPEVALLFYRRLLQMGLYNAELF  540 (677)
Q Consensus       461 ~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~l~~~~~l~~l~~~~~~~~~~~A~~~~~~al~~~p~~~~~~  540 (677)
                      ++..+|.++...|++++|+..++++....+..  ...+..+|.++.        ..|++++|+..|+++++.+|+++.++
T Consensus       205 ~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~--~~~~~~l~~~~~--------~~~~~~~A~~~~~~al~~~p~~~~~~  274 (388)
T d1w3ba_         205 AYINLGNVLKEARIFDRAVAAYLRALSLSPNH--AVVHGNLACVYY--------EQGLIDLAIDTYRRAIELQPHFPDAY  274 (388)
T ss_dssp             HHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTC--HHHHHHHHHHHH--------HTTCHHHHHHHHHHHHHTCSSCHHHH
T ss_pred             HHHHHhhhhhccccHHHHHHHHHHhHHHhhhH--HHHHHHHHHHHH--------HCCCHHHHHHHHHHHHHhCCCCHHHH
Confidence            99999999999999999999999999999988  999999999998        99999999999999999999999999


Q ss_pred             HHHHHHHHhccCHHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHhhcCCCCcccchhhhHHhcCCCHHHHHHHHHHHHc
Q psy16583        541 NNLALCCFYSQQYDMVVTCFERALSLALNENAADVWYNISHVAIITECSPFSFSTHTSYLFIQGISDTRLAIQCLHLALS  620 (677)
Q Consensus       541 ~~la~~~~~~g~~~~A~~~~~~al~~~~~p~~~~~~~~l~~~~~~~~~~p~~~~~~~~~~~l~~~g~~~~A~~~~~~al~  620 (677)
                      ..+|.++...|++++|+..+++++.  ..|.....+..++.++.                   ..|++++|+..|+++++
T Consensus       275 ~~l~~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~~~~l~~~~~-------------------~~~~~~~A~~~~~~al~  333 (388)
T d1w3ba_         275 CNLANALKEKGSVAEAEDCYNTALR--LCPTHADSLNNLANIKR-------------------EQGNIEEAVRLYRKALE  333 (388)
T ss_dssp             HHHHHHHHHHSCHHHHHHHHHHHHH--HCTTCHHHHHHHHHHHH-------------------TTTCHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHcCCHHHHHHHHHhhhc--cCCccchhhhHHHHHHH-------------------HCCCHHHHHHHHHHHHH
Confidence            9999999999999999999999999  88999999999999999                   99999999999999999


Q ss_pred             cCCCChHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhcCC
Q psy16583        621 IDSSHGLSQNNLAVLEAREGHIERASTYLQAAAASSPYLYETHYNQAVISNLVSV  675 (677)
Q Consensus       621 ~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~G~  675 (677)
                      ++|+++.++.++|.++...|++++|+..|+++++++|++++++.++|.+|..+||
T Consensus       334 ~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         334 VFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             SCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999999999999999999999999999999999999999999996
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure