Diaphorina citri psyllid: psy16587


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MPETTSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQEASGTSESYSQKCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQNRIE
ccccccccEEEEEEEEccccccccccccEEEEccccccccEEEEEEEccccccccccccEEEEEEEEEEcccHHHHHHHcccccccccEEEEEEEECcccccccccccccEEEEEEcccccccccccccc
*****SGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATL************************DLILT**********LGDIYLSATLYP************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPETTSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQEASGTSESYSQKCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQNRIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Multiple C2 and transmembrane domain-containing protein 1 confidentQ6DN14

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005544 [MF]calcium-dependent phospholipid bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DQV, chain A
Confidence level:very confident
Coverage over the Query: 7-72,92-119
View the alignment between query and template
View the model in PyMOL