Psyllid ID: psy16587


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MPETTSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQEASGTSESYSQKCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQNRIE
ccccccccEEEEEEEEccccccccccccEEEEccccccccEEEEEEEccccccccccccEEEEEEEEEEccHHHHHHHHcccccccccEEEEEEEEEcccccccccccccEEEEEEcccccccccccccc
ccccccccEEEEEEEEccccccccccccEEEEHHHcEccccEEEEEEEcccccccccccEEEEEEEEEEcccccccccHccccccHHHHcccEEEEccccccccccccEEEEEEEEcccccccccccccc
MPETTSGLVVELQVfdydwglqddfmgsasidlttlelgrCTDLiltledpnkpeenlgdiylsatlyprsqedrdqeasgtsesysqKCTDLILtledpnkpeenlgdiylsatlyprsqedrdqnrie
MPETTSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILtledpnkpeenLGDIYLSATLYPRSQEDrdqeasgtsesysqKCTDLILTLEDPNKPEENLGDIYlsatlyprsqedrdqnrie
MPETTSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQEASGTSESYSQKCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQNRIE
******GLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLE********LGDIYLSATL************************DLILT************DIYLSAT***************
*****SGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATL***************************************LGDIYLSATLYP************
MPETTSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPR*****************QKCTDLILTLEDPNKPEENLGDIYLSATLYPRS**********
M***TSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRSQ************S**QKCTDLILTLEDPNKPEENLGDIYLSATLYPR***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPETTSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQEASGTSESYSQKCTDLILTLEDPNKPEENLGDIYLSATLYPRSQEDRDQNRIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q6DN14 999 Multiple C2 and transmemb yes N/A 0.453 0.059 0.615 4e-16
Q5RJH2 878 Multiple C2 and transmemb no N/A 0.669 0.099 0.370 1e-05
Q6DN12 878 Multiple C2 and transmemb no N/A 0.669 0.099 0.370 1e-05
>sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/65 (61%), Positives = 50/65 (76%)

Query: 12  LQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRS 71
           ++VFDYD+GLQDDFMGSA +DLT LEL R TD+ LTL+DP+ P+ +LG I LS  L P+ 
Sbjct: 326 IKVFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDLGIILLSVILTPKE 385

Query: 72  QEDRD 76
            E RD
Sbjct: 386 GESRD 390





Homo sapiens (taxid: 9606)
>sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 Back     alignment and function description
>sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
270010849 976 hypothetical protein TcasGA2_TC014537 [T 0.523 0.069 0.632 1e-20
91083527 844 PREDICTED: similar to AGAP007646-PA [Tri 0.523 0.080 0.632 2e-20
357618684200 hypothetical protein KGM_04360 [Danaus p 0.538 0.35 0.661 2e-19
328790172 1429 PREDICTED: hypothetical protein LOC40890 0.453 0.041 0.493 4e-19
307212316 390 Multiple C2 and transmembrane domain-con 0.515 0.171 0.582 2e-18
307168021 1416 Multiple C2 and transmembrane domain-con 0.507 0.046 0.575 2e-18
322801752 1441 hypothetical protein SINV_06905 [Solenop 0.507 0.045 0.590 3e-18
332023289 1388 Multiple C2 and transmembrane domain-con 0.353 0.033 0.590 4e-18
340716187 929 PREDICTED: multiple C2 and transmembrane 0.353 0.049 0.575 1e-17
350396890 929 PREDICTED: multiple C2 and transmembrane 0.461 0.064 0.575 1e-17
>gi|270010849|gb|EFA07297.1| hypothetical protein TcasGA2_TC014537 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 62/68 (91%)

Query: 10  VELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYP 69
           ++++VFDYDWGLQDDFMGSA++DLTTL+LGR T++ + L+DP++P+  LG+I L+ATLYP
Sbjct: 311 IQIKVFDYDWGLQDDFMGSATLDLTTLDLGRATEVTMVLQDPDRPDTTLGEILLTATLYP 370

Query: 70  RSQEDRDQ 77
           +SQED++Q
Sbjct: 371 KSQEDKEQ 378




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91083527|ref|XP_973110.1| PREDICTED: similar to AGAP007646-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357618684|gb|EHJ71571.1| hypothetical protein KGM_04360 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328790172|ref|XP_392434.4| PREDICTED: hypothetical protein LOC408906 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307212316|gb|EFN88121.1| Multiple C2 and transmembrane domain-containing protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307168021|gb|EFN61345.1| Multiple C2 and transmembrane domain-containing protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322801752|gb|EFZ22349.1| hypothetical protein SINV_06905 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332023289|gb|EGI63543.1| Multiple C2 and transmembrane domain-containing protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340716187|ref|XP_003396582.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350396890|ref|XP_003484702.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
UNIPROTKB|F1MG14128 MCTP1 "Uncharacterized protein 0.476 0.484 0.612 3.3e-15
RGD|1305199 946 Mctp1 "multiple C2 domains, tr 0.884 0.121 0.449 4.6e-15
UNIPROTKB|Q6DN14 999 MCTP1 "Multiple C2 and transme 0.5 0.065 0.615 4.9e-15
FB|FBgn0034389 893 Mctp "Multiple C2 domain and t 0.561 0.081 0.527 2.4e-14
UNIPROTKB|E1C578 693 MCTP1 "Uncharacterized protein 0.884 0.165 0.401 1.9e-13
ZFIN|ZDB-GENE-050506-136 665 mctp2b "multiple C2 domains, t 0.538 0.105 0.408 5.7e-09
RGD|1562967 878 Mctp2 "multiple C2 domains, tr 0.807 0.119 0.370 1.1e-06
UNIPROTKB|F1Q381 879 MCTP2 "Uncharacterized protein 0.807 0.119 0.379 1.5e-06
UNIPROTKB|Q6DN12 878 MCTP2 "Multiple C2 and transme 0.807 0.119 0.370 2.4e-06
UNIPROTKB|F1MIR0 880 MCTP2 "Uncharacterized protein 0.807 0.119 0.342 2.4e-06
UNIPROTKB|F1MG14 MCTP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 192 (72.6 bits), Expect = 3.3e-15, P = 3.3e-15
 Identities = 38/62 (61%), Positives = 48/62 (77%)

Query:    12 LQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRS 71
             ++VFDYD+GLQDDFMGSA +DLT LEL R TD+ LTL+DP+ P+ +LG I LS  L P+ 
Sbjct:    47 IKVFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDLGIILLSVILTPKE 106

Query:    72 QE 73
              E
Sbjct:   107 GE 108




GO:0016021 "integral to membrane" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
RGD|1305199 Mctp1 "multiple C2 domains, transmembrane 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DN14 MCTP1 "Multiple C2 and transmembrane domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0034389 Mctp "Multiple C2 domain and transmembrane region protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1C578 MCTP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050506-136 mctp2b "multiple C2 domains, transmembrane 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1562967 Mctp2 "multiple C2 domains, transmembrane 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q381 MCTP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DN12 MCTP2 "Multiple C2 and transmembrane domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIR0 MCTP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6DN14MCTP1_HUMANNo assigned EC number0.61530.45380.0590yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
cd04042121 cd04042, C2A_MCTP_PRT, C2 domain first repeat foun 9e-19
cd04040115 cd04040, C2D_Tricalbin-like, C2 domain fourth repe 5e-05
cd08391121 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir 2e-04
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 4e-04
cd00030102 cd00030, C2, C2 domain 5e-04
smart00239101 smart00239, C2, Protein kinase C conserved region 0.001
cd04038145 cd04038, C2_ArfGAP, C2 domain present in Arf GTPas 0.003
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
 Score = 75.4 bits (186), Expect = 9e-19
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (1%)

Query: 10  VELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYP 69
           + ++VFDYD GL DDFMGSA +DL+TLEL + T++ L LEDPN  +E+LG I L  TL P
Sbjct: 63  LYIKVFDYDRGLTDDFMGSAFVDLSTLELNKPTEVKLKLEDPNS-DEDLGYISLVVTLTP 121


MCTPs are involved in Ca2+ signaling at the membrane. MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence. It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-II topology. Length = 121

>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG1028|consensus421 99.82
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.41
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.38
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.3
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.25
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.09
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.08
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.08
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.07
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.06
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.03
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.03
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 98.99
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 98.99
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 98.99
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 98.98
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 98.98
KOG1030|consensus168 98.98
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 98.97
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 98.96
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 98.96
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 98.94
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 98.93
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 98.93
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 98.92
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 98.91
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 98.87
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 98.87
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 98.86
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 98.83
PLN03008 868 Phospholipase D delta 98.82
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 98.79
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 98.78
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 98.78
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 98.77
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 98.75
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 98.75
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 98.74
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 98.74
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 98.73
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 98.71
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 98.69
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 98.69
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 98.69
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 98.69
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 98.68
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 98.68
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 98.67
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 98.67
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 98.66
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 98.65
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 98.65
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 98.65
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 98.65
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 98.64
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 98.63
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 98.63
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 98.61
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 98.61
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 98.59
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 98.58
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 98.57
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 98.57
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 98.57
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 98.57
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 98.57
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 98.56
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 98.55
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 98.54
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 98.53
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 98.52
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 98.52
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 98.51
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 98.51
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 98.5
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 98.48
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 98.45
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 98.42
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 98.42
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 98.4
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 98.4
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 98.4
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 98.37
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 98.37
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 98.37
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 98.35
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 98.33
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 98.32
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 98.31
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 98.3
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 98.3
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 98.3
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 98.29
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 98.28
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 98.24
KOG2059|consensus 800 98.23
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 98.23
PLN032002102 cellulose synthase-interactive protein; Provisiona 98.22
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 98.21
KOG1013|consensus362 98.15
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 98.13
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 98.13
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 98.12
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 98.12
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 98.11
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 98.1
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 98.09
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 98.08
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 98.0
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 97.95
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 97.93
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 97.92
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 97.89
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 97.87
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 97.83
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 97.81
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 97.8
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 97.8
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 97.74
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 97.74
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 97.74
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 97.7
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 97.7
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 97.69
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 97.66
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 97.66
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 97.65
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 97.65
KOG0696|consensus 683 97.63
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 97.61
KOG1028|consensus 421 97.6
KOG0696|consensus 683 97.49
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 97.43
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 97.42
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 97.42
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 97.41
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 97.32
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 97.29
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 97.29
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 97.26
PLN02952599 phosphoinositide phospholipase C 97.26
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 97.22
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 97.21
cd00030102 C2 C2 domain. The C2 domain was first identified i 97.12
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 97.08
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 97.07
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 97.05
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 96.96
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 96.93
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 96.9
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 96.89
PLN02223537 phosphoinositide phospholipase C 96.89
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 96.89
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 96.88
PLN02270 808 phospholipase D alpha 96.84
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 96.78
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 96.74
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 96.64
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 96.51
PLN02228567 Phosphoinositide phospholipase C 96.5
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 96.34
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 96.16
KOG1328|consensus 1103 96.15
PLN02230598 phosphoinositide phospholipase C 4 96.12
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 96.1
PLN02222581 phosphoinositide phospholipase C 2 96.0
KOG0169|consensus746 95.89
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 95.83
KOG0905|consensus1639 95.78
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 95.58
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 95.51
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 95.47
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 95.35
KOG1030|consensus 168 95.21
KOG2059|consensus 800 95.09
KOG1326|consensus1105 94.71
PLN02352 758 phospholipase D epsilon 94.58
KOG1031|consensus 1169 92.93
PLN032002102 cellulose synthase-interactive protein; Provisiona 92.16
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 91.97
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 91.1
cd08690 155 C2_Freud-1 C2 domain found in 5' repressor element 90.75
KOG1327|consensus 529 90.52
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 90.37
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 90.0
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 89.76
cd00030102 C2 C2 domain. The C2 domain was first identified i 89.66
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 89.21
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 88.91
cd05137 395 RasGAP_CLA2_BUD2 CLA2/BUD2 functions as a GTPase-a 88.22
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 87.51
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 87.5
cd04038 145 C2_ArfGAP C2 domain present in Arf GTPase Activati 87.12
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 86.79
KOG0905|consensus1639 86.72
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 86.47
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 86.28
KOG2060|consensus405 85.97
KOG1327|consensus 529 85.54
PLN03008 868 Phospholipase D delta 85.23
KOG1264|consensus1267 85.21
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 84.97
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 84.12
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 81.68
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 81.3
KOG1328|consensus1103 80.13
>KOG1028|consensus Back     alignment and domain information
Probab=99.82  E-value=8.9e-20  Score=151.83  Aligned_cols=101  Identities=26%  Similarity=0.362  Sum_probs=87.5

Q ss_pred             CCCceEEEEEEeCCCCCCCCcceEEEEeCccccCCceeEEEEecCCCCCC-CCCcccEEEEEEEecCcchhhhccccccc
Q psy16587          5 TSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKP-EENLGDIYLSATLYPRSQEDRDQEASGTS   83 (130)
Q Consensus         5 ~~~~~L~~~V~D~D~~~~dD~iG~~~i~L~~v~~~~~~~~~~~L~~~~~~-~~~~G~I~l~L~~~p~~~~~~~~~~~~~~   83 (130)
                      ...++|+|.|||+|||++||+||++.+||..++....+.+|.+|...... .+.+|+|+++|||.|.++           
T Consensus       230 l~~~~L~l~V~~~drfsr~~~iGev~~~l~~~~~~~~~~~w~~l~~~~~~~~~~~gel~~sL~Y~p~~g-----------  298 (421)
T KOG1028|consen  230 LSNRVLHLSVYDFDRFSRHDFIGEVILPLGEVDLLSTTLFWKDLQPSSTDSEELAGELLLSLCYLPTAG-----------  298 (421)
T ss_pred             hccCEEEEEEEecCCcccccEEEEEEecCccccccccceeeeccccccCCcccccceEEEEEEeecCCC-----------
Confidence            46789999999999999999999999999999999999999999875322 334479999999999986           


Q ss_pred             cccccccceEEEEE-eCCCCCCCC---CCCcEEEEEEccCccccc
Q psy16587         84 ESYSQKCTDLILTL-EDPNKPEEN---LGDIYLSATLYPRSQEDR  124 (130)
Q Consensus        84 ~~~s~~~~~l~V~l-~a~nL~~~~---~~dpyVk~~L~~~~~~s~  124 (130)
                              +|+|.| +||||+.++   .+|||||+++.+..++.+
T Consensus       299 --------~ltv~v~kar~L~~~~~~~~~d~~Vk~~l~~~~~~~~  335 (421)
T KOG1028|consen  299 --------RLTVVVIKARNLKSMDVGGLSDPYVKVTLLDGDKRLS  335 (421)
T ss_pred             --------eEEEEEEEecCCCcccCCCCCCccEEEEEecCCceee
Confidence                    886666 999999775   889999999999885544



>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG1030|consensus Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>KOG1030|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1031|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd05137 RasGAP_CLA2_BUD2 CLA2/BUD2 functions as a GTPase-activating protein (GAP) for BUD1/RSR1 and is necessary for proper bud-site selection in yeast Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>KOG2060|consensus Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 2e-09
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 2e-09
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 3e-09
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 3e-09
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 5e-09
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 3e-08
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 2e-07
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 9e-07
3nsj_A540 Perforin-1; pore forming protein, immune system; H 2e-06
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 3e-06
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 2e-05
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-05
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 2e-05
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 4e-05
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 4e-05
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 6e-05
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 9e-05
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 2e-04
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 2e-04
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 3e-04
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 5e-04
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 6e-04
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 6e-04
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 9e-04
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
 Score = 51.1 bits (123), Expect = 2e-09
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 9   VVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATL 67
           V+E+ VFD D     DF+G  +I L ++  G+    +L  +D  +     G IYL   L
Sbjct: 74  VLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQ--AFKGVIYLEMDL 130


>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.75
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.69
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.31
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.24
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.24
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.22
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.2
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.15
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.15
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.03
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.0
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 98.92
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 98.9
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 98.86
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 98.85
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 98.77
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 98.75
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 98.72
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 98.71
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 98.71
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 98.68
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 98.68
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 98.68
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 98.68
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 98.67
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 98.65
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 98.65
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 98.65
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 98.65
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 98.64
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 98.64
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 98.64
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 98.64
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 98.63
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 98.62
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 98.62
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 98.61
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 98.59
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 98.59
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 98.59
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 98.59
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 98.58
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 98.56
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 98.55
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 98.54
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 98.52
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 98.5
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 98.49
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 98.46
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 98.45
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 98.42
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 98.42
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 98.41
3nsj_A540 Perforin-1; pore forming protein, immune system; H 98.4
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 98.38
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 98.35
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 98.35
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 98.35
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 98.34
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 98.3
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 98.28
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 98.28
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 98.26
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 98.09
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 98.09
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 97.8
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 97.79
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 97.69
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 97.69
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 97.65
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 97.51
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 97.5
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 97.41
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.36
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 97.28
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 97.25
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 97.21
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 97.2
3m7f_B 176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 97.08
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 97.06
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 96.97
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 96.86
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 96.7
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 96.66
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.49
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 96.3
3nsj_A 540 Perforin-1; pore forming protein, immune system; H 96.23
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 96.14
2cjs_A 167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 95.44
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 94.79
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 94.57
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 94.32
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 94.1
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 90.83
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 90.53
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 90.15
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=99.75  E-value=1.5e-17  Score=128.21  Aligned_cols=94  Identities=27%  Similarity=0.473  Sum_probs=82.5

Q ss_pred             CceEEEEEEeCCCCCCCCcceEEEEeCccccCCceeEEEEecCCCCC-CCCCcccEEEEEEEecCcchhhhccccccccc
Q psy16587          7 GLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNK-PEENLGDIYLSATLYPRSQEDRDQEASGTSES   85 (130)
Q Consensus         7 ~~~L~~~V~D~D~~~~dD~iG~~~i~L~~v~~~~~~~~~~~L~~~~~-~~~~~G~I~l~L~~~p~~~~~~~~~~~~~~~~   85 (130)
                      ...|.|.|||+|++++||+||++.|||+++..++..+.|++|....+ ..+..|+|+++++|.|..+             
T Consensus        84 ~~~l~~~V~d~d~~~~~~~lG~~~i~l~~l~~~~~~~~w~~L~~~~~~~~~~~G~i~l~l~~~p~~~-------------  150 (284)
T 2r83_A           84 GKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAG-------------  150 (284)
T ss_dssp             TCEEEEEEEECCSSSCCCEEEEEEEEGGGCCCSSCEEEEEECBCCSSCCCCCCCEEEEEEEEETTTT-------------
T ss_pred             cCEEEEEEEECCCCCCCceeEEEEEcchhcccCCcceeEEEeeccccccccccccEEEEEEecCcCC-------------
Confidence            57999999999999999999999999999999999999999987543 2457899999999999775             


Q ss_pred             cccccceEEEEE-eCCCCCCCC---CCCcEEEEEEccC
Q psy16587         86 YSQKCTDLILTL-EDPNKPEEN---LGDIYLSATLYPR  119 (130)
Q Consensus        86 ~s~~~~~l~V~l-~a~nL~~~~---~~dpyVk~~L~~~  119 (130)
                            .|.|.+ +|+||+.++   .+||||++++++.
T Consensus       151 ------~l~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~  182 (284)
T 2r83_A          151 ------KLTVVILEAKNLKKMDVGGLSDPYVKIHLMQN  182 (284)
T ss_dssp             ------EEEEEEEEEESCCCCSTTSCCCEEEEEEEEET
T ss_pred             ------ceEEEEEEeECCCCcCCCCCcCeEEEEEEEeC
Confidence                  677777 999999765   7899999999764



>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 2e-07
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 3e-06
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 9e-06
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 1e-05
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 4e-05
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 5e-05
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 9e-05
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 0.001
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.4 bits (104), Expect = 2e-07
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 11  ELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATL 67
           E+ VFD D     DF+G  +I L ++  G+    +L  +D  +  +  G IYL   L
Sbjct: 69  EVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFK--GVIYLEMDL 123


>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.19
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.14
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.09
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.0
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.86
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.83
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 98.83
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 98.82
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 98.8
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.8
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.79
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 98.78
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 98.73
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 98.69
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 98.69
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 98.69
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.67
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 98.67
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 98.62
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 98.57
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 98.56
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 98.46
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 98.3
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 98.29
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 98.13
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 98.1
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.0
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 97.97
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 97.85
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 97.8
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.62
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 97.38
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 97.37
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 97.2
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 97.19
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 97.15
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 96.19
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 93.5
d1u00a2115 Chaperone protein hscA (Hsc66) {Escherichia coli [ 83.08
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Domain from cytosolic phospholipase A2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.19  E-value=1.6e-11  Score=82.78  Aligned_cols=62  Identities=13%  Similarity=0.292  Sum_probs=53.9

Q ss_pred             cCCC-CceEEEEEEeCCCCCCCCcceEEEEeCccccCCceeEEEEecCCCCCCCCCcccEEEEEEEecC
Q psy16587          3 ETTS-GLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPR   70 (130)
Q Consensus         3 ~~~~-~~~L~~~V~D~D~~~~dD~iG~~~i~L~~v~~~~~~~~~~~L~~~~~~~~~~G~I~l~L~~~p~   70 (130)
                      +.++ ...|+|.|||+|.+ +||+||++.|||+++..++..+.|++|++..+     |+|+++|.+.|.
T Consensus        64 i~~~~~~~L~v~V~d~d~~-~d~~lG~~~i~L~~l~~~~~~~~~~~L~~~~~-----g~i~~~l~~~~s  126 (126)
T d1rlwa_          64 LDPNQENVLEITLMDANYV-MDETLGTATFTVSSMKVGEKKEVPFIFNQVTE-----MVLEMSLEVASS  126 (126)
T ss_dssp             ECTTSCCEEEEEEEECCSS-CCEEEEEEEEEGGGSCTTCEEEEEEEETTTEE-----EEEEEEEECCCC
T ss_pred             ccCcccCcEEEEEEECCCC-CCCeEEEEEEEHHHccCCCeEEEEEEccCCCe-----EEEEEEEEEEeC
Confidence            3343 45799999999988 79999999999999999999999999987655     999999998873



>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure