Psyllid ID: psy16587
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| 270010849 | 976 | hypothetical protein TcasGA2_TC014537 [T | 0.523 | 0.069 | 0.632 | 1e-20 | |
| 91083527 | 844 | PREDICTED: similar to AGAP007646-PA [Tri | 0.523 | 0.080 | 0.632 | 2e-20 | |
| 357618684 | 200 | hypothetical protein KGM_04360 [Danaus p | 0.538 | 0.35 | 0.661 | 2e-19 | |
| 328790172 | 1429 | PREDICTED: hypothetical protein LOC40890 | 0.453 | 0.041 | 0.493 | 4e-19 | |
| 307212316 | 390 | Multiple C2 and transmembrane domain-con | 0.515 | 0.171 | 0.582 | 2e-18 | |
| 307168021 | 1416 | Multiple C2 and transmembrane domain-con | 0.507 | 0.046 | 0.575 | 2e-18 | |
| 322801752 | 1441 | hypothetical protein SINV_06905 [Solenop | 0.507 | 0.045 | 0.590 | 3e-18 | |
| 332023289 | 1388 | Multiple C2 and transmembrane domain-con | 0.353 | 0.033 | 0.590 | 4e-18 | |
| 340716187 | 929 | PREDICTED: multiple C2 and transmembrane | 0.353 | 0.049 | 0.575 | 1e-17 | |
| 350396890 | 929 | PREDICTED: multiple C2 and transmembrane | 0.461 | 0.064 | 0.575 | 1e-17 |
| >gi|270010849|gb|EFA07297.1| hypothetical protein TcasGA2_TC014537 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 104 bits (259), Expect = 1e-20, Method: Compositional matrix adjust.
Identities = 43/68 (63%), Positives = 62/68 (91%)
Query: 10 VELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYP 69
++++VFDYDWGLQDDFMGSA++DLTTL+LGR T++ + L+DP++P+ LG+I L+ATLYP
Sbjct: 311 IQIKVFDYDWGLQDDFMGSATLDLTTLDLGRATEVTMVLQDPDRPDTTLGEILLTATLYP 370
Query: 70 RSQEDRDQ 77
+SQED++Q
Sbjct: 371 KSQEDKEQ 378
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91083527|ref|XP_973110.1| PREDICTED: similar to AGAP007646-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|357618684|gb|EHJ71571.1| hypothetical protein KGM_04360 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|328790172|ref|XP_392434.4| PREDICTED: hypothetical protein LOC408906 isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307212316|gb|EFN88121.1| Multiple C2 and transmembrane domain-containing protein 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307168021|gb|EFN61345.1| Multiple C2 and transmembrane domain-containing protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322801752|gb|EFZ22349.1| hypothetical protein SINV_06905 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332023289|gb|EGI63543.1| Multiple C2 and transmembrane domain-containing protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|340716187|ref|XP_003396582.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350396890|ref|XP_003484702.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| UNIPROTKB|F1MG14 | 128 | MCTP1 "Uncharacterized protein | 0.476 | 0.484 | 0.612 | 3.3e-15 | |
| RGD|1305199 | 946 | Mctp1 "multiple C2 domains, tr | 0.884 | 0.121 | 0.449 | 4.6e-15 | |
| UNIPROTKB|Q6DN14 | 999 | MCTP1 "Multiple C2 and transme | 0.5 | 0.065 | 0.615 | 4.9e-15 | |
| FB|FBgn0034389 | 893 | Mctp "Multiple C2 domain and t | 0.561 | 0.081 | 0.527 | 2.4e-14 | |
| UNIPROTKB|E1C578 | 693 | MCTP1 "Uncharacterized protein | 0.884 | 0.165 | 0.401 | 1.9e-13 | |
| ZFIN|ZDB-GENE-050506-136 | 665 | mctp2b "multiple C2 domains, t | 0.538 | 0.105 | 0.408 | 5.7e-09 | |
| RGD|1562967 | 878 | Mctp2 "multiple C2 domains, tr | 0.807 | 0.119 | 0.370 | 1.1e-06 | |
| UNIPROTKB|F1Q381 | 879 | MCTP2 "Uncharacterized protein | 0.807 | 0.119 | 0.379 | 1.5e-06 | |
| UNIPROTKB|Q6DN12 | 878 | MCTP2 "Multiple C2 and transme | 0.807 | 0.119 | 0.370 | 2.4e-06 | |
| UNIPROTKB|F1MIR0 | 880 | MCTP2 "Uncharacterized protein | 0.807 | 0.119 | 0.342 | 2.4e-06 |
| UNIPROTKB|F1MG14 MCTP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 192 (72.6 bits), Expect = 3.3e-15, P = 3.3e-15
Identities = 38/62 (61%), Positives = 48/62 (77%)
Query: 12 LQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPRS 71
++VFDYD+GLQDDFMGSA +DLT LEL R TD+ LTL+DP+ P+ +LG I LS L P+
Sbjct: 47 IKVFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTLKDPHYPDHDLGIILLSVILTPKE 106
Query: 72 QE 73
E
Sbjct: 107 GE 108
|
|
| RGD|1305199 Mctp1 "multiple C2 domains, transmembrane 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DN14 MCTP1 "Multiple C2 and transmembrane domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034389 Mctp "Multiple C2 domain and transmembrane region protein" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C578 MCTP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050506-136 mctp2b "multiple C2 domains, transmembrane 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1562967 Mctp2 "multiple C2 domains, transmembrane 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q381 MCTP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DN12 MCTP2 "Multiple C2 and transmembrane domain-containing protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MIR0 MCTP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 130 | |||
| cd04042 | 121 | cd04042, C2A_MCTP_PRT, C2 domain first repeat foun | 9e-19 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 5e-05 | |
| cd08391 | 121 | cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir | 2e-04 | |
| cd08376 | 116 | cd08376, C2B_MCTP_PRT, C2 domain second repeat fou | 4e-04 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 5e-04 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 0.001 | |
| cd04038 | 145 | cd04038, C2_ArfGAP, C2 domain present in Arf GTPas | 0.003 |
| >gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
Score = 75.4 bits (186), Expect = 9e-19
Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 1/60 (1%)
Query: 10 VELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYP 69
+ ++VFDYD GL DDFMGSA +DL+TLEL + T++ L LEDPN +E+LG I L TL P
Sbjct: 63 LYIKVFDYDRGLTDDFMGSAFVDLSTLELNKPTEVKLKLEDPNS-DEDLGYISLVVTLTP 121
|
MCTPs are involved in Ca2+ signaling at the membrane. MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence. It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-II topology. Length = 121 |
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| KOG1028|consensus | 421 | 99.82 | ||
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.41 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.38 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.3 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.25 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.09 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.08 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.08 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.07 | |
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.06 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.03 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.03 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 98.99 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 98.99 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 98.99 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 98.98 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 98.98 | |
| KOG1030|consensus | 168 | 98.98 | ||
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 98.97 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 98.96 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 98.96 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 98.94 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 98.93 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 98.93 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 98.92 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 98.91 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 98.87 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 98.87 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 98.86 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 98.83 | |
| PLN03008 | 868 | Phospholipase D delta | 98.82 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 98.79 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 98.78 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 98.78 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 98.77 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 98.75 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 98.75 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 98.74 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 98.74 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 98.73 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 98.71 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 98.69 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 98.69 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 98.69 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 98.69 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 98.68 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 98.68 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 98.67 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 98.67 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 98.66 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 98.65 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 98.65 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 98.65 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 98.65 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 98.64 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 98.63 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 98.63 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 98.61 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 98.61 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 98.59 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 98.58 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 98.57 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 98.57 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 98.57 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 98.57 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 98.57 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 98.56 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 98.55 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 98.54 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 98.53 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 98.52 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 98.52 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 98.51 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 98.51 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 98.5 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 98.48 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 98.45 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 98.42 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 98.42 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 98.4 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 98.4 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 98.4 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 98.37 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 98.37 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 98.37 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 98.35 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 98.33 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 98.32 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 98.31 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 98.3 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 98.3 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 98.3 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 98.29 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 98.28 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 98.24 | |
| KOG2059|consensus | 800 | 98.23 | ||
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 98.23 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 98.22 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 98.21 | |
| KOG1013|consensus | 362 | 98.15 | ||
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 98.13 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 98.13 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 98.12 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 98.12 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 98.11 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 98.1 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 98.09 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 98.08 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 98.0 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 97.95 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 97.93 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 97.92 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 97.89 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 97.87 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 97.83 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 97.81 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 97.8 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 97.8 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 97.74 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 97.74 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 97.74 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 97.7 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 97.7 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 97.69 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 97.66 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 97.66 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 97.65 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 97.65 | |
| KOG0696|consensus | 683 | 97.63 | ||
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 97.61 | |
| KOG1028|consensus | 421 | 97.6 | ||
| KOG0696|consensus | 683 | 97.49 | ||
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 97.43 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 97.42 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 97.42 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 97.41 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 97.32 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 97.29 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 97.29 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 97.26 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 97.26 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 97.22 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 97.21 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 97.12 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 97.08 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 97.07 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 97.05 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 96.96 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 96.93 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 96.9 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 96.89 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 96.89 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 96.89 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 96.88 | |
| PLN02270 | 808 | phospholipase D alpha | 96.84 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 96.78 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 96.74 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 96.64 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 96.51 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 96.5 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 96.34 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 96.16 | |
| KOG1328|consensus | 1103 | 96.15 | ||
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 96.12 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 96.1 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 96.0 | |
| KOG0169|consensus | 746 | 95.89 | ||
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 95.83 | |
| KOG0905|consensus | 1639 | 95.78 | ||
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 95.58 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 95.51 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 95.47 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 95.35 | |
| KOG1030|consensus | 168 | 95.21 | ||
| KOG2059|consensus | 800 | 95.09 | ||
| KOG1326|consensus | 1105 | 94.71 | ||
| PLN02352 | 758 | phospholipase D epsilon | 94.58 | |
| KOG1031|consensus | 1169 | 92.93 | ||
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 92.16 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 91.97 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 91.1 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 90.75 | |
| KOG1327|consensus | 529 | 90.52 | ||
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 90.37 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 90.0 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 89.76 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 89.66 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 89.21 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 88.91 | |
| cd05137 | 395 | RasGAP_CLA2_BUD2 CLA2/BUD2 functions as a GTPase-a | 88.22 | |
| PF10358 | 143 | NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; | 87.51 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 87.5 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 87.12 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 86.79 | |
| KOG0905|consensus | 1639 | 86.72 | ||
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 86.47 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 86.28 | |
| KOG2060|consensus | 405 | 85.97 | ||
| KOG1327|consensus | 529 | 85.54 | ||
| PLN03008 | 868 | Phospholipase D delta | 85.23 | |
| KOG1264|consensus | 1267 | 85.21 | ||
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 84.97 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 84.12 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 81.68 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 81.3 | |
| KOG1328|consensus | 1103 | 80.13 |
| >KOG1028|consensus | Back alignment and domain information |
|---|
Probab=99.82 E-value=8.9e-20 Score=151.83 Aligned_cols=101 Identities=26% Similarity=0.362 Sum_probs=87.5
Q ss_pred CCCceEEEEEEeCCCCCCCCcceEEEEeCccccCCceeEEEEecCCCCCC-CCCcccEEEEEEEecCcchhhhccccccc
Q psy16587 5 TSGLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKP-EENLGDIYLSATLYPRSQEDRDQEASGTS 83 (130)
Q Consensus 5 ~~~~~L~~~V~D~D~~~~dD~iG~~~i~L~~v~~~~~~~~~~~L~~~~~~-~~~~G~I~l~L~~~p~~~~~~~~~~~~~~ 83 (130)
...++|+|.|||+|||++||+||++.+||..++....+.+|.+|...... .+.+|+|+++|||.|.++
T Consensus 230 l~~~~L~l~V~~~drfsr~~~iGev~~~l~~~~~~~~~~~w~~l~~~~~~~~~~~gel~~sL~Y~p~~g----------- 298 (421)
T KOG1028|consen 230 LSNRVLHLSVYDFDRFSRHDFIGEVILPLGEVDLLSTTLFWKDLQPSSTDSEELAGELLLSLCYLPTAG----------- 298 (421)
T ss_pred hccCEEEEEEEecCCcccccEEEEEEecCccccccccceeeeccccccCCcccccceEEEEEEeecCCC-----------
Confidence 46789999999999999999999999999999999999999999875322 334479999999999986
Q ss_pred cccccccceEEEEE-eCCCCCCCC---CCCcEEEEEEccCccccc
Q psy16587 84 ESYSQKCTDLILTL-EDPNKPEEN---LGDIYLSATLYPRSQEDR 124 (130)
Q Consensus 84 ~~~s~~~~~l~V~l-~a~nL~~~~---~~dpyVk~~L~~~~~~s~ 124 (130)
+|+|.| +||||+.++ .+|||||+++.+..++.+
T Consensus 299 --------~ltv~v~kar~L~~~~~~~~~d~~Vk~~l~~~~~~~~ 335 (421)
T KOG1028|consen 299 --------RLTVVVIKARNLKSMDVGGLSDPYVKVTLLDGDKRLS 335 (421)
T ss_pred --------eEEEEEEEecCCCcccCCCCCCccEEEEEecCCceee
Confidence 886666 999999775 889999999999885544
|
|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >KOG1030|consensus | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >KOG0169|consensus | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >KOG1030|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >KOG1031|consensus | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd05137 RasGAP_CLA2_BUD2 CLA2/BUD2 functions as a GTPase-activating protein (GAP) for BUD1/RSR1 and is necessary for proper bud-site selection in yeast | Back alignment and domain information |
|---|
| >PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >KOG2060|consensus | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 130 | |||
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 2e-09 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 2e-09 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 3e-09 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 3e-09 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 5e-09 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 3e-08 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 2e-07 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 9e-07 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 2e-06 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 3e-06 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 2e-05 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 2e-05 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 2e-05 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 4e-05 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 4e-05 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 6e-05 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 9e-05 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 2e-04 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 2e-04 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 3e-04 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 5e-04 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 6e-04 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 6e-04 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 9e-04 |
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
Score = 51.1 bits (123), Expect = 2e-09
Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 2/59 (3%)
Query: 9 VVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATL 67
V+E+ VFD D DF+G +I L ++ G+ +L +D + G IYL L
Sbjct: 74 VLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQ--AFKGVIYLEMDL 130
|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.75 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.69 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.31 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.24 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.24 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.22 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.2 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.15 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.15 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.03 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.0 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 98.92 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 98.9 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 98.86 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 98.85 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 98.77 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 98.75 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 98.72 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 98.71 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 98.71 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 98.68 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 98.68 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 98.68 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 98.68 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 98.67 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 98.65 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 98.65 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 98.65 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 98.65 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 98.64 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 98.64 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 98.64 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 98.64 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 98.63 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 98.62 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 98.62 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 98.61 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 98.59 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 98.59 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 98.59 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 98.59 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 98.58 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 98.56 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 98.55 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 98.54 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 98.52 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 98.5 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 98.49 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 98.46 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 98.45 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 98.42 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 98.42 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 98.41 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 98.4 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 98.38 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 98.35 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 98.35 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 98.35 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 98.34 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 98.3 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 98.28 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 98.28 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 98.26 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 98.09 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 98.09 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 97.8 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 97.79 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 97.69 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 97.69 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 97.65 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 97.51 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 97.5 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 97.41 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 97.36 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 97.28 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 97.25 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 97.21 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 97.2 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 97.08 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 97.06 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 96.97 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 96.86 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 96.7 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 96.66 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 96.49 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 96.3 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 96.23 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 96.14 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 95.44 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 94.79 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 94.57 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 94.32 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 94.1 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 90.83 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 90.53 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 90.15 |
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
Probab=99.75 E-value=1.5e-17 Score=128.21 Aligned_cols=94 Identities=27% Similarity=0.473 Sum_probs=82.5
Q ss_pred CceEEEEEEeCCCCCCCCcceEEEEeCccccCCceeEEEEecCCCCC-CCCCcccEEEEEEEecCcchhhhccccccccc
Q psy16587 7 GLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNK-PEENLGDIYLSATLYPRSQEDRDQEASGTSES 85 (130)
Q Consensus 7 ~~~L~~~V~D~D~~~~dD~iG~~~i~L~~v~~~~~~~~~~~L~~~~~-~~~~~G~I~l~L~~~p~~~~~~~~~~~~~~~~ 85 (130)
...|.|.|||+|++++||+||++.|||+++..++..+.|++|....+ ..+..|+|+++++|.|..+
T Consensus 84 ~~~l~~~V~d~d~~~~~~~lG~~~i~l~~l~~~~~~~~w~~L~~~~~~~~~~~G~i~l~l~~~p~~~------------- 150 (284)
T 2r83_A 84 GKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAG------------- 150 (284)
T ss_dssp TCEEEEEEEECCSSSCCCEEEEEEEEGGGCCCSSCEEEEEECBCCSSCCCCCCCEEEEEEEEETTTT-------------
T ss_pred cCEEEEEEEECCCCCCCceeEEEEEcchhcccCCcceeEEEeeccccccccccccEEEEEEecCcCC-------------
Confidence 57999999999999999999999999999999999999999987543 2457899999999999775
Q ss_pred cccccceEEEEE-eCCCCCCCC---CCCcEEEEEEccC
Q psy16587 86 YSQKCTDLILTL-EDPNKPEEN---LGDIYLSATLYPR 119 (130)
Q Consensus 86 ~s~~~~~l~V~l-~a~nL~~~~---~~dpyVk~~L~~~ 119 (130)
.|.|.+ +|+||+.++ .+||||++++++.
T Consensus 151 ------~l~v~v~~a~~L~~~d~~~~~dpyv~v~~~~~ 182 (284)
T 2r83_A 151 ------KLTVVILEAKNLKKMDVGGLSDPYVKIHLMQN 182 (284)
T ss_dssp ------EEEEEEEEEESCCCCSTTSCCCEEEEEEEEET
T ss_pred ------ceEEEEEEeECCCCcCCCCCcCeEEEEEEEeC
Confidence 677777 999999765 7899999999764
|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 130 | ||||
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 2e-07 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 3e-06 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 9e-06 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 1e-05 | |
| d1rh8a_ | 142 | b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax | 4e-05 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 5e-05 | |
| d2nq3a1 | 133 | b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc | 9e-05 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 0.001 |
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 44.4 bits (104), Expect = 2e-07
Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 2/57 (3%)
Query: 11 ELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATL 67
E+ VFD D DF+G +I L ++ G+ +L +D + + G IYL L
Sbjct: 69 EVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFK--GVIYLEMDL 123
|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.19 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.14 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.09 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.0 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 98.86 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 98.83 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 98.83 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 98.82 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 98.8 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.8 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.79 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 98.78 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 98.73 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.69 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 98.69 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 98.69 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.67 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 98.67 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 98.62 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 98.57 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 98.56 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 98.46 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 98.3 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.29 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 98.13 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 98.1 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 98.0 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 97.97 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 97.85 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 97.8 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 97.62 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 97.38 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 97.37 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 97.2 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 97.19 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 97.15 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 96.19 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 93.5 | |
| d1u00a2 | 115 | Chaperone protein hscA (Hsc66) {Escherichia coli [ | 83.08 |
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: Domain from cytosolic phospholipase A2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.19 E-value=1.6e-11 Score=82.78 Aligned_cols=62 Identities=13% Similarity=0.292 Sum_probs=53.9
Q ss_pred cCCC-CceEEEEEEeCCCCCCCCcceEEEEeCccccCCceeEEEEecCCCCCCCCCcccEEEEEEEecC
Q psy16587 3 ETTS-GLVVELQVFDYDWGLQDDFMGSASIDLTTLELGRCTDLILTLEDPNKPEENLGDIYLSATLYPR 70 (130)
Q Consensus 3 ~~~~-~~~L~~~V~D~D~~~~dD~iG~~~i~L~~v~~~~~~~~~~~L~~~~~~~~~~G~I~l~L~~~p~ 70 (130)
+.++ ...|+|.|||+|.+ +||+||++.|||+++..++..+.|++|++..+ |+|+++|.+.|.
T Consensus 64 i~~~~~~~L~v~V~d~d~~-~d~~lG~~~i~L~~l~~~~~~~~~~~L~~~~~-----g~i~~~l~~~~s 126 (126)
T d1rlwa_ 64 LDPNQENVLEITLMDANYV-MDETLGTATFTVSSMKVGEKKEVPFIFNQVTE-----MVLEMSLEVASS 126 (126)
T ss_dssp ECTTSCCEEEEEEEECCSS-CCEEEEEEEEEGGGSCTTCEEEEEEEETTTEE-----EEEEEEEECCCC
T ss_pred ccCcccCcEEEEEEECCCC-CCCeEEEEEEEHHHccCCCeEEEEEEccCCCe-----EEEEEEEEEEeC
Confidence 3343 45799999999988 79999999999999999999999999987655 999999998873
|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|