Diaphorina citri psyllid: psy16658


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
ALGAVTIGTGLAWTSPVLPILTSTTETSVLNEPVDRGQASLIGSLIAIGAIFGALPAGSIADKFGRKPVILAFCIPFIISWVLILFAKNVLMLFAARFIAGVATGGLSAIIPMFIGEIAESSIRAGVATGGLSAIIPMFIGEIAESSIRGISAIIVGIVQFIMTALSVVLVDKAGRRILLLLSDFVMALCLGVLGFYFYMMEDGKDVSSISFLPLLSVIFFIVMFSLGYGPIPWMMVGELFAPEVKGSATGIAVALNWISAFIVTLCFVFLVKNLGSAATFWIFSVICFVGTLFTFVLVPETKGKTLNQIQRELGGGK
ccccccccccCECccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHECccccccccHHHHHHHHcccc
ALGAVTIGTGLAWTSPVLPILTSTTETSVLNEPVDRGQASLIGSLIAIGAIFGALPAGSIADKFGRKPVILAFCIPFIISWVLILFAKNVLMLFAARFIAGVATGGLSAIIPMFIGEIAESSIRAGVATGGLSAIIPMFIGEIAESSIRGISAIIVGIVQFIMTALSVVLVDKAGRRILLLLSDFVMALCLGVLGFYFYMMEDGKDVSSISFLPLLSVIFFIVMFSLGYGPIPWMMVGELFAPEVKGSATGIAVALNWISAFIVTLCFVFLVKNLGSAATFWIFSVICFVGTLFTFVLVPETKGKTLNQIQRELG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALGAVTIGTGLAWTSPVLPILTSTTETSVLNEPVDRGQASLIGSLIAIGAIFGALPAGSIADKFGRKPVILAFCIPFIISWVLILFAKNVLMLFAARFIAGVATGGLSAIIPMFIGEIAESSIRAGVATGGLSAIIPMFIGEIAESSIRGISAIIVGIVQFIMTALSVVLVDKAGRRILLLLSDFVMALCLGVLGFYFYMMEDGKDVSSISFLPLLSVIFFIVMFSLGYGPIPWMMVGELFAPEVKGSATGIAVALNWISAFIVTLCFVFLVKNLGSAATFWIFSVICFVGTLFTFVLVPETKGKTLNQIQRELGGGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0015770 [BP]sucrose transportprobableGO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015771 [BP]trehalose transportprobableGO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0055056 [MF]D-glucose transmembrane transporter activityprobableGO:0005355, GO:0022891, GO:0022892, GO:0051119, GO:1901476, GO:0005215, GO:0015149, GO:0022857, GO:0003674, GO:0015145, GO:0015144
GO:0009705 [CC]plant-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000325, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0015767 [BP]lactose transportprobableGO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0012506 [CC]vesicle membraneprobableGO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0031988, GO:0005575, GO:0012505, GO:0043227, GO:0043226, GO:0044422, GO:0031982
GO:0015758 [BP]glucose transportprobableGO:0008645, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0015749, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015768 [BP]maltose transportprobableGO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015574 [MF]trehalose transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0051119, GO:1901476, GO:0005215, GO:0015157, GO:0022857, GO:0003674, GO:0015154, GO:0015151, GO:0015144, GO:0042947
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0030136 [CC]clathrin-coated vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 2-315
View the alignment between query and template
View the model in PyMOL