Diaphorina citri psyllid: psy16673


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370---
MKPVMCDNERIRLVILGGQGVGKSCILKRFLFNTYSDRYRSTVEDLYSRDFHVGAVTIKEIPIVVAGNKSDMTSHHRAVHLEDVSEWLYCELPKLRYVIQSSSFGDEIPIVVAGNKSDMTSHHRAVHLEDVSEWLYCELPKLRYVDILDTCGDLQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQEIPIVVAGNKSDMTSHHRAVHLEDVDILDTCGDLQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQLLECSAKDNYNIKEVFRTFLTLSQILTTNGDENSLKRRSSAYVNKGKV
cccccccccEEEEEEECcccccHHHHHHHHHHccccccccccHHHcCEEEEEEccCEEEEEEECccccccccccccccEEccccccHHHcccHHHHHHHHcccccccccEEEEECcccccccccccccccccEEEEECccCEEEEEEEEcccccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccHHHHHHHHccccCCccccccccHHHHHEEEEEEEccccccHHHHHHHHHHHHHHHccccccHHHcccccccccEEEEcccccccccEEEcHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHccccccccccccccccccccccccc
*****CDNERIRLVILGGQGVGKSCILKRFLFNTYSDRYRSTVEDLYSRDFHVGAVTIKEIPIVVAGNKSDMTSHHRAVHLEDVSEWLYCELPKLRYVIQSSSFGDEIPIVVAGNKSDMTSHHRAVHLEDVSEWLYCELPKLRYVDILDTCGDLQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQEIPIVVAGNKSDMTSHHRAVHLEDVDILDTCGDLQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQLLECSAKDNYNIKEVFRTFLTLSQIL**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPVMCDNERIRLVILGGQGVGKSCILKRFLFNTYSDRYRSTVEDLYSRDFHVGAVTIKEIPIVVAGNKSDMTSHHRAVHLEDVSEWLYCELPKLRYVIQSSSFGDEIPIVVAGNKSDMTSHHRAVHLEDVSEWLYCELPKLRYVDILDTCGDLQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQEIPIVVAGNKSDMTSHHRAVHLEDVDILDTCGDLQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQFPAMRRLSIATAHAFLLVYSTTCLESFQSVKCYFEEIREQRQDFQLLECSAKDNYNIKEVFRTFLTLSQILTTNGDENSLKRRSSAYVNKGKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0031982 [CC]vesicleprobableGO:0005575, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FN4, chain A
Confidence level:very confident
Coverage over the Query: 7-59,145-215,307-350
View the alignment between query and template
View the model in PyMOL
Template: 1C1Y, chain A
Confidence level:very confident
Coverage over the Query: 224-284,297-348
View the alignment between query and template
View the model in PyMOL
Template: 3CLV, chain A
Confidence level:very confident
Coverage over the Query: 5-53,118,134-218,309-348
View the alignment between query and template
View the model in PyMOL
Template: 1MKY, chain A
Confidence level:confident
Coverage over the Query: 11-32,50-135,163-279,292-361
View the alignment between query and template
View the model in PyMOL