Diaphorina citri psyllid: psy16678


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMRKKT
ccccCEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccEEccccccccccccccccccccCEEcccEEEEEEEEEEEEEEccc
**GHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMRKKT
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMRKKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004989 [MF]octopamine receptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0008227
GO:0030819 [BP]positive regulation of cAMP biosynthetic processprobableGO:0019220, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:1900371, GO:0045981, GO:0080090, GO:0030816, GO:0030817, GO:0030814, GO:0009891, GO:0030810, GO:0050789, GO:0065007, GO:0048518, GO:0045935, GO:0045937, GO:0019219, GO:0009889, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0051173, GO:0030799, GO:0030808, GO:1900542, GO:1900544, GO:0030804, GO:0030801, GO:1900373, GO:0030802, GO:0006140, GO:0010562, GO:0048522
GO:0004993 [MF]serotonin receptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0008227
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0050877 [BP]neurological system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0044093 [BP]positive regulation of molecular functionprobableGO:0008150, GO:0065009, GO:0065007
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007188 [BP]adenylate cyclase-modulating G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0051179 [BP]localizationprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0051380 [MF]norepinephrine bindingprobableGO:1901338, GO:0003674, GO:0005488, GO:0097159
GO:0048585 [BP]negative regulation of response to stimulusprobableGO:0008150, GO:0048519, GO:0065007, GO:0048583, GO:0050789
GO:0051482 [BP]elevation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathwayprobableGO:0050801, GO:0042592, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0072507, GO:0051716, GO:0072503, GO:0065007, GO:0065008, GO:0007186, GO:0019725, GO:0006875, GO:0006874, GO:0009987, GO:0006873, GO:0050794, GO:0044763, GO:0030003, GO:0055065, GO:0055080, GO:0007154, GO:0055082, GO:0044700, GO:0051480, GO:0007200, GO:0050896, GO:0007204, GO:0048878, GO:0008150, GO:0055074
GO:0001993 [BP]regulation of systemic arterial blood pressure by norepinephrine-epinephrineprobableGO:0003073, GO:0032501, GO:0044707, GO:0008015, GO:0003008, GO:0008150, GO:0003013, GO:0008217, GO:0065007, GO:0065008, GO:0044699, GO:0003044
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SN6, chain R
Confidence level:very confident
Coverage over the Query: 1-49
View the alignment between query and template
View the model in PyMOL