Psyllid ID: psy16678
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| 332017514 | 446 | Octopamine receptor beta-2R [Acromyrmex | 0.712 | 0.139 | 0.758 | 7e-21 | |
| 307205929 | 414 | Octopamine receptor beta-2R [Harpegnatho | 0.712 | 0.149 | 0.741 | 1e-20 | |
| 322788170 | 443 | hypothetical protein SINV_06087 [Solenop | 0.712 | 0.139 | 0.741 | 3e-20 | |
| 307172193 | 421 | Octopamine receptor beta-2R [Camponotus | 0.712 | 0.147 | 0.725 | 5e-20 | |
| 291278187 | 404 | putative GPCR-type octopamine beta recep | 0.712 | 0.153 | 0.677 | 2e-19 | |
| 195109568 | 1286 | GI23112 [Drosophila mojavensis] gi|19391 | 0.804 | 0.054 | 0.589 | 1e-18 | |
| 194764829 | 628 | GF23002 [Drosophila ananassae] gi|190614 | 0.701 | 0.097 | 0.704 | 1e-18 | |
| 195394393 | 1190 | GJ10602 [Drosophila virilis] gi|19414253 | 0.804 | 0.058 | 0.589 | 2e-18 | |
| 242020588 | 432 | class A rhodopsin-like G-protein coupled | 0.712 | 0.143 | 0.709 | 2e-18 | |
| 442618720 | 630 | Octbeta2R, isoform F [Drosophila melanog | 0.701 | 0.096 | 0.655 | 2e-18 |
| >gi|332017514|gb|EGI58225.1| Octopamine receptor beta-2R [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Score = 104 bits (259), Expect = 7e-21, Method: Compositional matrix adjust.
Identities = 47/62 (75%), Positives = 54/62 (87%)
Query: 6 YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICD 65
YYAIVKPLKYPINMTKRVVAFMLL WVSPA+ISFVPI GWYTT E+ +R++HP +C+
Sbjct: 149 YYAIVKPLKYPINMTKRVVAFMLLACWVSPAIISFVPIFYGWYTTEENSVHRHKHPELCE 208
Query: 66 FK 67
FK
Sbjct: 209 FK 210
|
Source: Acromyrmex echinatior Species: Acromyrmex echinatior Genus: Acromyrmex Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307205929|gb|EFN84067.1| Octopamine receptor beta-2R [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322788170|gb|EFZ13952.1| hypothetical protein SINV_06087 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307172193|gb|EFN63718.1| Octopamine receptor beta-2R [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|291278187|gb|ADD91575.1| putative GPCR-type octopamine beta receptor, partial [Schistocerca gregaria] | Back alignment and taxonomy information |
|---|
| >gi|195109568|ref|XP_001999356.1| GI23112 [Drosophila mojavensis] gi|193915950|gb|EDW14817.1| GI23112 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|194764829|ref|XP_001964530.1| GF23002 [Drosophila ananassae] gi|190614802|gb|EDV30326.1| GF23002 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195394393|ref|XP_002055827.1| GJ10602 [Drosophila virilis] gi|194142536|gb|EDW58939.1| GJ10602 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|242020588|ref|XP_002430734.1| class A rhodopsin-like G-protein coupled receptor GPRoar1, putative [Pediculus humanus corporis] gi|212515931|gb|EEB17996.1| class A rhodopsin-like G-protein coupled receptor GPRoar1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|442618720|ref|NP_001163596.2| Octbeta2R, isoform F [Drosophila melanogaster] gi|440217348|gb|ACZ94893.2| Octbeta2R, isoform F [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| FB|FBgn0038063 | 536 | Octbeta2R "Octbeta2R" [Drosoph | 0.827 | 0.134 | 0.594 | 6e-19 | |
| FB|FBgn0250910 | 1256 | Octbeta3R "Octbeta3R" [Drosoph | 0.804 | 0.055 | 0.575 | 1e-17 | |
| FB|FBgn0038980 | 508 | oa2 "octopamine receptor 2" [D | 0.827 | 0.141 | 0.554 | 6.1e-17 | |
| ZFIN|ZDB-GENE-070410-32 | 409 | adrb2b "adrenergic receptor, b | 0.885 | 0.188 | 0.329 | 1.7e-06 | |
| UNIPROTKB|Q8UUY8 | 409 | adrb2 "Beta-2 adrenergic recep | 0.885 | 0.188 | 0.329 | 4.7e-06 | |
| ZFIN|ZDB-GENE-081022-145 | 390 | adrb1 "adrenergic receptor, be | 0.862 | 0.192 | 0.316 | 5.5e-06 | |
| UNIPROTKB|E1BWY5 | 406 | E1BWY5 "Uncharacterized protei | 0.701 | 0.150 | 0.354 | 7.6e-06 | |
| UNIPROTKB|Q8HZG2 | 378 | Q8HZG2 "Adrenergic receptor be | 0.701 | 0.161 | 0.354 | 1.1e-05 | |
| UNIPROTKB|Q8HZG3 | 378 | Q8HZG3 "Adrenergic receptor be | 0.701 | 0.161 | 0.354 | 1.1e-05 | |
| UNIPROTKB|Q8HZG1 | 380 | Q8HZG1 "Adrenergic receptor be | 0.701 | 0.160 | 0.354 | 1.1e-05 |
| FB|FBgn0038063 Octbeta2R "Octbeta2R" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 235 (87.8 bits), Expect = 6.0e-19, P = 6.0e-19
Identities = 44/74 (59%), Positives = 55/74 (74%)
Query: 6 YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICD 65
YYAIVKPLKYPI+MTKRVV MLLN W+SPA++SF+PI GWYTT +H ++ Q+P C
Sbjct: 252 YYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCS 311
Query: 66 F--KKCILVESSNV 77
F K V SS++
Sbjct: 312 FVVNKYYAVISSSI 325
|
|
| FB|FBgn0250910 Octbeta3R "Octbeta3R" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038980 oa2 "octopamine receptor 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070410-32 adrb2b "adrenergic receptor, beta 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8UUY8 adrb2 "Beta-2 adrenergic receptor" [Oncorhynchus mykiss (taxid:8022)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081022-145 adrb1 "adrenergic receptor, beta 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BWY5 E1BWY5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8HZG2 Q8HZG2 "Adrenergic receptor beta-2" [Gorilla gorilla (taxid:9593)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8HZG3 Q8HZG3 "Adrenergic receptor beta-2" [Pan troglodytes (taxid:9598)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8HZG1 Q8HZG1 "Adrenergic receptor beta-2" [Pongo pygmaeus (taxid:9600)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 87 | |||
| pfam00001 | 251 | pfam00001, 7tm_1, 7 transmembrane receptor (rhodop | 2e-05 |
| >gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) | Back alignment and domain information |
|---|
Score = 40.4 bits (95), Expect = 2e-05
Identities = 18/47 (38%), Positives = 25/47 (53%)
Query: 6 YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSE 52
Y AIV PL+Y T R ++L VWV ++S P++ W T E
Sbjct: 77 YLAIVHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTVE 123
|
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| KOG4220|consensus | 503 | 98.87 | ||
| PF00001 | 257 | 7tm_1: 7 transmembrane receptor (rhodopsin family) | 98.43 | |
| PHA03087 | 335 | G protein-coupled chemokine receptor-like protein; | 98.41 | |
| PHA02834 | 323 | chemokine receptor-like protein; Provisional | 98.35 | |
| KOG4219|consensus | 423 | 98.24 | ||
| PHA03235 | 409 | DNA packaging protein UL33; Provisional | 98.23 | |
| PHA02638 | 417 | CC chemokine receptor-like protein; Provisional | 98.2 | |
| PHA03234 | 338 | DNA packaging protein UL33; Provisional | 98.13 | |
| PF10320 | 257 | 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep | 96.67 | |
| PF10328 | 274 | 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept | 96.62 | |
| KOG2087|consensus | 363 | 96.26 | ||
| PF10323 | 283 | 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept | 94.51 | |
| PF03383 | 153 | Serpentine_r_xa: Caenorhabditis serpentine recepto | 91.74 |
| >KOG4220|consensus | Back alignment and domain information |
|---|
Probab=98.87 E-value=3.9e-09 Score=70.43 Aligned_cols=64 Identities=19% Similarity=0.319 Sum_probs=50.1
Q ss_pred CceeeEEeeecCCCCCceechhHHHHHHHHHhHHHHHHHhhhhhhccccccccccccCCCCCcceEee
Q psy16678 1 MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKK 68 (87)
Q Consensus 1 is~dRy~~i~~pl~~~~~~~~~~~~~~~~~~Wv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~ 68 (87)
||+|||.+|.+||.|+..+|.+++..++.+.|+++++.-.|-++ .|.-..... ....+.|..++
T Consensus 124 ISFDRYFsVTrPLtYrakRTtkrA~~MI~~AW~iSfiLWaPaIl-~WqyivGkr---Tv~~~eC~iQF 187 (503)
T KOG4220|consen 124 ISFDRYFSVTRPLTYRAKRTTKRAGLMIGAAWVLSFVLWAPAIL-FWQYIVGKR---TVPDGECYIQF 187 (503)
T ss_pred eeeecceeecccccccccccchHHHHHHHHHHHHHHHHHHHHHH-hhHhheeee---ecCCCceEEEe
Confidence 68999999999999999999999999999999999998777644 455433322 33456785543
|
|
| >PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PHA03087 G protein-coupled chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02834 chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4219|consensus | Back alignment and domain information |
|---|
| >PHA03235 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PHA02638 CC chemokine receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03234 DNA packaging protein UL33; Provisional | Back alignment and domain information |
|---|
| >PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG2087|consensus | Back alignment and domain information |
|---|
| >PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF03383 Serpentine_r_xa: Caenorhabditis serpentine receptor-like protein, class xa; InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 87 | ||||
| 2y00_B | 315 | Turkey Beta1 Adrenergic Receptor With Stabilising M | 4e-06 | ||
| 2vt4_A | 313 | Turkey Beta1 Adrenergic Receptor With Stabilising M | 4e-06 | ||
| 3sn6_R | 514 | Crystal Structure Of The Beta2 Adrenergic Receptor- | 1e-05 | ||
| 3p0g_A | 501 | Structure Of A Nanobody-Stabilized Active State Of | 1e-05 | ||
| 2rh1_A | 500 | High Resolution Crystal Structure Of Human B2-Adren | 2e-05 | ||
| 3d4s_A | 490 | Cholesterol Bound Form Of Human Beta2 Adrenergic Re | 2e-05 | ||
| 3kj6_A | 366 | Crystal Structure Of A Methylated Beta2 Adrenergic | 2e-05 | ||
| 3pds_A | 458 | Irreversible Agonist-Beta2 Adrenoceptor Complex Len | 3e-05 | ||
| 2r4s_A | 342 | Crystal Structure Of The Human Beta2 Adrenoceptor L | 4e-05 | ||
| 2r4r_A | 365 | Crystal Structure Of The Human Beta2 Adrenoceptor L | 5e-05 | ||
| 4gbr_A | 309 | N-terminal T4 Lysozyme Fusion Facilitates Crystalli | 7e-05 |
| >pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 | Back alignment and structure |
|
| >pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 | Back alignment and structure |
| >pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 | Back alignment and structure |
| >pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 | Back alignment and structure |
| >pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 | Back alignment and structure |
| >pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 | Back alignment and structure |
| >pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 | Back alignment and structure |
| >pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 | Back alignment and structure |
| >pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 | Back alignment and structure |
| >pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 | Back alignment and structure |
| >pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 87 | |||
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 6e-17 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 2e-16 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 2e-14 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 8e-14 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 1e-12 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 1e-12 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 3e-12 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 7e-10 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 4e-06 |
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 | Back alignment and structure |
|---|
Score = 72.6 bits (178), Expect = 6e-17
Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
Query: 6 YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYT-TSEHLKYRYQHPNIC 64
Y+AI P KY +TK ++L VW+ + SF+PI WY T + Y C
Sbjct: 281 YFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCC 340
Query: 65 DF 66
DF
Sbjct: 341 DF 342
|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 | Back alignment and structure |
|---|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| 4grv_A | 510 | Neurotensin receptor type 1, lysozyme chimera; G-p | 98.73 | |
| 3uon_A | 467 | Human M2 muscarinic acetylcholine, receptor T4 LY | 98.6 | |
| 4ea3_A | 434 | Fusion protein of nociceptin receptor and cytochr; | 98.6 | |
| 3v2y_A | 520 | Sphingosine 1-phosphate receptor 1, lysozyme CHIM; | 98.6 | |
| 2rh1_A | 500 | Beta-2-adrenergic receptor/T4-lysozyme chimera; GP | 98.58 | |
| 1u19_A | 349 | Rhodopsin; G protein-coupled receptor, membrane pr | 98.57 | |
| 4dkl_A | 464 | MU-type opioid receptor, lysozyme chimera; G-prote | 98.56 | |
| 3vw7_A | 484 | Proteinase-activated receptor 1, lysozyme; high re | 98.56 | |
| 3eml_A | 488 | Human adenosine A2A receptor/T4 lysozyme chimera; | 98.52 | |
| 3odu_A | 502 | C-X-C chemokine receptor type 4, lysozyme chimera; | 98.52 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 98.52 | |
| 2ks9_A | 364 | Substance-P receptor; water, autodock, NK1, neurop | 98.44 | |
| 4eiy_A | 447 | Adenosine receptor A2A/soluble cytochrome B562 CH; | 98.42 | |
| 4amj_A | 315 | Beta-1 adrenergic receptor; membrane protein, 7TMR | 98.42 | |
| 2lnl_A | 296 | C-X-C chemokine receptor type 1; G protein coupled | 98.41 | |
| 3rze_A | 452 | Histamine H1 receptor, lysozyme chimera; structura | 98.4 | |
| 3sn6_R | 514 | Lysozyme, beta-2 adrenergic receptor; seven transm | 98.29 | |
| 3pbl_A | 481 | D(3) dopamine receptor, lysozyme chimera; structur | 98.22 | |
| 1hll_A | 32 | Alpha-2A adrenergic receptor; helix-linker-helix, | 98.0 |
| >4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=98.73 E-value=6.6e-10 Score=74.37 Aligned_cols=47 Identities=17% Similarity=0.322 Sum_probs=42.3
Q ss_pred CceeeEEeeecCCCCCceechhHHHHHHHHHhHHHHHHHhhhhhhccc
Q psy16678 1 MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWY 48 (87)
Q Consensus 1 is~dRy~~i~~pl~~~~~~~~~~~~~~~~~~Wv~~~~~~~~~~~~~~~ 48 (87)
||+|||+||++|++|...++++++..+++++|+++++.++|+++ .+.
T Consensus 131 is~dRy~ai~~P~~~~~~~t~~~~~~~i~~~W~~s~~~~~p~~~-~~~ 177 (510)
T 4grv_A 131 LSVARYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLF-TMG 177 (510)
T ss_dssp HHHHHHHHHHSCCCCCCCCCCSCCHHHHHHHHHHHHHHHTTHHH-HEE
T ss_pred HHHHheEEEeccccccccccccccceeehHHHHHHHHHHHHHHH-hhc
Confidence 58899999999999999999999999999999999999999865 443
|
| >3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* | Back alignment and structure |
|---|
| >3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* | Back alignment and structure |
|---|
| >2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* | Back alignment and structure |
|---|
| >1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... | Back alignment and structure |
|---|
| >4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* | Back alignment and structure |
|---|
| >3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* | Back alignment and structure |
|---|
| >3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* | Back alignment and structure |
|---|
| >2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A | Back alignment and structure |
|---|
| >4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A | Back alignment and structure |
|---|
| >4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* | Back alignment and structure |
|---|
| >2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* | Back alignment and structure |
|---|
| >3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| d1u19a_ | 348 | Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | 97.0 |
| >d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Family A G protein-coupled receptor-like superfamily: Family A G protein-coupled receptor-like family: Rhodopsin-like domain: Rhodopsin species: Cow (Bos taurus) [TaxId: 9913]
Probab=97.00 E-value=6.8e-05 Score=45.65 Aligned_cols=43 Identities=14% Similarity=0.203 Sum_probs=32.9
Q ss_pred CceeeEEeeecCCCCCceechhHHHHHHHHHhHHHHHHHhhhhh
Q psy16678 1 MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIM 44 (87)
Q Consensus 1 is~dRy~~i~~pl~~~~~~~~~~~~~~~~~~Wv~~~~~~~~~~~ 44 (87)
+++|||.+|++|+++... +.++....+...|..+++...++.+
T Consensus 131 is~~R~~~i~~p~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~ 173 (348)
T d1u19a_ 131 LAIERYVVVCKPMSNFRF-GENHAIMGVAFTWVMALACAAPPLV 173 (348)
T ss_dssp HHHHHHHHHTCCSSSCCC-CHHHHHHHHHHHHHHHHHHHSGGGT
T ss_pred hhcccceeeecccccccc-ccccccccceeeehhhhheeccccc
Confidence 478999999999998765 5556666677778888777777744
|