Psyllid ID: psy16678


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMRKKT
ccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccEEccccccccccccccccccccEEEcccEEEEEEEEEEEEEEccc
cccccEEEEEccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccEEEEEEEcccEEEEHHHcccc
mlghgyyaivkplkypinMTKRVVAFMLLNVWvspavisfvpimcgwyttsehlkyryqhpnicdfkkCILVESSNVCTTYLMRKKT
MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESsnvcttylmrkkt
MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMRKKT
***HGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLM****
**GHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMRKKT
MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMRKKT
*LGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMR***
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHiiii
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKKCILVESSNVCTTYLMRKKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q4LBB6 1256 Octopamine receptor beta- no N/A 0.804 0.055 0.575 1e-19
Q4LBB9 536 Octopamine receptor beta- no N/A 0.701 0.113 0.655 7e-19
Q9VCZ3 508 Octopamine receptor beta- no N/A 0.712 0.122 0.612 3e-17
P07700 483 Beta-1 adrenergic recepto yes N/A 0.701 0.126 0.354 2e-05
Q19084 468 Tyramine receptor tyra-2 yes N/A 0.747 0.138 0.323 0.0001
P42290 457 D(1B) dopamine receptor O N/A N/A 0.678 0.129 0.354 0.0002
P07550 413 Beta-2 adrenergic recepto yes N/A 0.701 0.147 0.354 0.0002
P34971 466 Beta-1 adrenergic recepto yes N/A 0.701 0.130 0.322 0.0002
P47899 480 Beta-1 adrenergic recepto yes N/A 0.701 0.127 0.322 0.0002
Q9TST5 418 Beta-2 adrenergic recepto N/A N/A 0.701 0.145 0.354 0.0002
>sp|Q4LBB6|OCTB3_DROME Octopamine receptor beta-3R OS=Drosophila melanogaster GN=Octbeta3R PE=2 SV=4 Back     alignment and function desciption
 Score = 94.7 bits (234), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/73 (57%), Positives = 51/73 (69%), Gaps = 3/73 (4%)

Query: 6   YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICD 65
           YYAIV+PL+YP+NMT + V FML NVW+ PA+ISF PI  GWYTT EHL+    HP+ C 
Sbjct: 239 YYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHPDQCS 298

Query: 66  F---KKCILVESS 75
           F   K   L+ SS
Sbjct: 299 FVVNKAYALISSS 311




Receptor for octopamine. Octopamine (OA) is a neurotransmitter, neurohormone, and neuromodulator in invertebrates. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Drosophila melanogaster (taxid: 7227)
>sp|Q4LBB9|OCTB2_DROME Octopamine receptor beta-2R OS=Drosophila melanogaster GN=Octbeta2R PE=2 SV=2 Back     alignment and function description
>sp|Q9VCZ3|OCTB1_DROME Octopamine receptor beta-1R OS=Drosophila melanogaster GN=oa2 PE=2 SV=1 Back     alignment and function description
>sp|P07700|ADRB1_MELGA Beta-1 adrenergic receptor OS=Meleagris gallopavo GN=ADRB1 PE=1 SV=1 Back     alignment and function description
>sp|Q19084|OAR2_CAEEL Tyramine receptor tyra-2 OS=Caenorhabditis elegans GN=tyra-2 PE=2 SV=3 Back     alignment and function description
>sp|P42290|DRD5_XENLA D(1B) dopamine receptor OS=Xenopus laevis GN=drd5 PE=2 SV=1 Back     alignment and function description
>sp|P07550|ADRB2_HUMAN Beta-2 adrenergic receptor OS=Homo sapiens GN=ADRB2 PE=1 SV=3 Back     alignment and function description
>sp|P34971|ADRB1_MOUSE Beta-1 adrenergic receptor OS=Mus musculus GN=Adrb1 PE=1 SV=2 Back     alignment and function description
>sp|P47899|ADRB1_MACMU Beta-1 adrenergic receptor OS=Macaca mulatta GN=ADRB1 PE=3 SV=1 Back     alignment and function description
>sp|Q9TST5|ADRB2_FELCA Beta-2 adrenergic receptor OS=Felis catus GN=ADRB2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
332017514 446 Octopamine receptor beta-2R [Acromyrmex 0.712 0.139 0.758 7e-21
307205929 414 Octopamine receptor beta-2R [Harpegnatho 0.712 0.149 0.741 1e-20
322788170 443 hypothetical protein SINV_06087 [Solenop 0.712 0.139 0.741 3e-20
307172193 421 Octopamine receptor beta-2R [Camponotus 0.712 0.147 0.725 5e-20
291278187 404 putative GPCR-type octopamine beta recep 0.712 0.153 0.677 2e-19
195109568 1286 GI23112 [Drosophila mojavensis] gi|19391 0.804 0.054 0.589 1e-18
194764829 628 GF23002 [Drosophila ananassae] gi|190614 0.701 0.097 0.704 1e-18
195394393 1190 GJ10602 [Drosophila virilis] gi|19414253 0.804 0.058 0.589 2e-18
242020588 432 class A rhodopsin-like G-protein coupled 0.712 0.143 0.709 2e-18
442618720 630 Octbeta2R, isoform F [Drosophila melanog 0.701 0.096 0.655 2e-18
>gi|332017514|gb|EGI58225.1| Octopamine receptor beta-2R [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  104 bits (259), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 47/62 (75%), Positives = 54/62 (87%)

Query: 6   YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICD 65
           YYAIVKPLKYPINMTKRVVAFMLL  WVSPA+ISFVPI  GWYTT E+  +R++HP +C+
Sbjct: 149 YYAIVKPLKYPINMTKRVVAFMLLACWVSPAIISFVPIFYGWYTTEENSVHRHKHPELCE 208

Query: 66  FK 67
           FK
Sbjct: 209 FK 210




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307205929|gb|EFN84067.1| Octopamine receptor beta-2R [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322788170|gb|EFZ13952.1| hypothetical protein SINV_06087 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307172193|gb|EFN63718.1| Octopamine receptor beta-2R [Camponotus floridanus] Back     alignment and taxonomy information
>gi|291278187|gb|ADD91575.1| putative GPCR-type octopamine beta receptor, partial [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|195109568|ref|XP_001999356.1| GI23112 [Drosophila mojavensis] gi|193915950|gb|EDW14817.1| GI23112 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194764829|ref|XP_001964530.1| GF23002 [Drosophila ananassae] gi|190614802|gb|EDV30326.1| GF23002 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195394393|ref|XP_002055827.1| GJ10602 [Drosophila virilis] gi|194142536|gb|EDW58939.1| GJ10602 [Drosophila virilis] Back     alignment and taxonomy information
>gi|242020588|ref|XP_002430734.1| class A rhodopsin-like G-protein coupled receptor GPRoar1, putative [Pediculus humanus corporis] gi|212515931|gb|EEB17996.1| class A rhodopsin-like G-protein coupled receptor GPRoar1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|442618720|ref|NP_001163596.2| Octbeta2R, isoform F [Drosophila melanogaster] gi|440217348|gb|ACZ94893.2| Octbeta2R, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
FB|FBgn0038063 536 Octbeta2R "Octbeta2R" [Drosoph 0.827 0.134 0.594 6e-19
FB|FBgn0250910 1256 Octbeta3R "Octbeta3R" [Drosoph 0.804 0.055 0.575 1e-17
FB|FBgn0038980 508 oa2 "octopamine receptor 2" [D 0.827 0.141 0.554 6.1e-17
ZFIN|ZDB-GENE-070410-32 409 adrb2b "adrenergic receptor, b 0.885 0.188 0.329 1.7e-06
UNIPROTKB|Q8UUY8 409 adrb2 "Beta-2 adrenergic recep 0.885 0.188 0.329 4.7e-06
ZFIN|ZDB-GENE-081022-145 390 adrb1 "adrenergic receptor, be 0.862 0.192 0.316 5.5e-06
UNIPROTKB|E1BWY5 406 E1BWY5 "Uncharacterized protei 0.701 0.150 0.354 7.6e-06
UNIPROTKB|Q8HZG2 378 Q8HZG2 "Adrenergic receptor be 0.701 0.161 0.354 1.1e-05
UNIPROTKB|Q8HZG3 378 Q8HZG3 "Adrenergic receptor be 0.701 0.161 0.354 1.1e-05
UNIPROTKB|Q8HZG1 380 Q8HZG1 "Adrenergic receptor be 0.701 0.160 0.354 1.1e-05
FB|FBgn0038063 Octbeta2R "Octbeta2R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 235 (87.8 bits), Expect = 6.0e-19, P = 6.0e-19
 Identities = 44/74 (59%), Positives = 55/74 (74%)

Query:     6 YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICD 65
             YYAIVKPLKYPI+MTKRVV  MLLN W+SPA++SF+PI  GWYTT +H ++  Q+P  C 
Sbjct:   252 YYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCS 311

Query:    66 F--KKCILVESSNV 77
             F   K   V SS++
Sbjct:   312 FVVNKYYAVISSSI 325




GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0008227 "G-protein coupled amine receptor activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0004989 "octopamine receptor activity" evidence=IDA
GO:0045887 "positive regulation of synaptic growth at neuromuscular junction" evidence=IMP
FB|FBgn0250910 Octbeta3R "Octbeta3R" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038980 oa2 "octopamine receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-32 adrb2b "adrenergic receptor, beta 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8UUY8 adrb2 "Beta-2 adrenergic receptor" [Oncorhynchus mykiss (taxid:8022)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081022-145 adrb1 "adrenergic receptor, beta 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWY5 E1BWY5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HZG2 Q8HZG2 "Adrenergic receptor beta-2" [Gorilla gorilla (taxid:9593)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HZG3 Q8HZG3 "Adrenergic receptor beta-2" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HZG1 Q8HZG1 "Adrenergic receptor beta-2" [Pongo pygmaeus (taxid:9600)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
pfam00001251 pfam00001, 7tm_1, 7 transmembrane receptor (rhodop 2e-05
>gnl|CDD|215646 pfam00001, 7tm_1, 7 transmembrane receptor (rhodopsin family) Back     alignment and domain information
 Score = 40.4 bits (95), Expect = 2e-05
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 6   YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSE 52
           Y AIV PL+Y    T R    ++L VWV   ++S  P++  W  T E
Sbjct: 77  YLAIVHPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLFSWLRTVE 123


This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins. Length = 251

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
KOG4220|consensus 503 98.87
PF00001257 7tm_1: 7 transmembrane receptor (rhodopsin family) 98.43
PHA03087 335 G protein-coupled chemokine receptor-like protein; 98.41
PHA02834 323 chemokine receptor-like protein; Provisional 98.35
KOG4219|consensus 423 98.24
PHA03235 409 DNA packaging protein UL33; Provisional 98.23
PHA02638 417 CC chemokine receptor-like protein; Provisional 98.2
PHA03234 338 DNA packaging protein UL33; Provisional 98.13
PF10320257 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemorecep 96.67
PF10328274 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemorecept 96.62
KOG2087|consensus 363 96.26
PF10323283 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemorecept 94.51
PF03383153 Serpentine_r_xa: Caenorhabditis serpentine recepto 91.74
>KOG4220|consensus Back     alignment and domain information
Probab=98.87  E-value=3.9e-09  Score=70.43  Aligned_cols=64  Identities=19%  Similarity=0.319  Sum_probs=50.1

Q ss_pred             CceeeEEeeecCCCCCceechhHHHHHHHHHhHHHHHHHhhhhhhccccccccccccCCCCCcceEee
Q psy16678          1 MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYRYQHPNICDFKK   68 (87)
Q Consensus         1 is~dRy~~i~~pl~~~~~~~~~~~~~~~~~~Wv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~   68 (87)
                      ||+|||.+|.+||.|+..+|.+++..++.+.|+++++.-.|-++ .|.-.....   ....+.|..++
T Consensus       124 ISFDRYFsVTrPLtYrakRTtkrA~~MI~~AW~iSfiLWaPaIl-~WqyivGkr---Tv~~~eC~iQF  187 (503)
T KOG4220|consen  124 ISFDRYFSVTRPLTYRAKRTTKRAGLMIGAAWVLSFVLWAPAIL-FWQYIVGKR---TVPDGECYIQF  187 (503)
T ss_pred             eeeecceeecccccccccccchHHHHHHHHHHHHHHHHHHHHHH-hhHhheeee---ecCCCceEEEe
Confidence            68999999999999999999999999999999999998777644 455433322   33456785543



>PF00001 7tm_1: 7 transmembrane receptor (rhodopsin family) Rhodopsin-like GPCR superfamily signature 5-hydroxytryptamine 7 receptor signature bradykinin receptor signature gastrin receptor signature melatonin receptor signature olfactory receptor signature; InterPro: IPR000276 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA03087 G protein-coupled chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA02834 chemokine receptor-like protein; Provisional Back     alignment and domain information
>KOG4219|consensus Back     alignment and domain information
>PHA03235 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PHA02638 CC chemokine receptor-like protein; Provisional Back     alignment and domain information
>PHA03234 DNA packaging protein UL33; Provisional Back     alignment and domain information
>PF10320 7TM_GPCR_Srsx: Serpentine type 7TM GPCR chemoreceptor Srsx; InterPro: IPR019424 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF10328 7TM_GPCR_Srx: Serpentine type 7TM GPCR chemoreceptor Srx; InterPro: IPR019430 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG2087|consensus Back     alignment and domain information
>PF10323 7TM_GPCR_Srv: Serpentine type 7TM GPCR chemoreceptor Srv; InterPro: IPR019426 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PF03383 Serpentine_r_xa: Caenorhabditis serpentine receptor-like protein, class xa; InterPro: IPR005047 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
2y00_B 315 Turkey Beta1 Adrenergic Receptor With Stabilising M 4e-06
2vt4_A 313 Turkey Beta1 Adrenergic Receptor With Stabilising M 4e-06
3sn6_R 514 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-05
3p0g_A 501 Structure Of A Nanobody-Stabilized Active State Of 1e-05
2rh1_A 500 High Resolution Crystal Structure Of Human B2-Adren 2e-05
3d4s_A 490 Cholesterol Bound Form Of Human Beta2 Adrenergic Re 2e-05
3kj6_A 366 Crystal Structure Of A Methylated Beta2 Adrenergic 2e-05
3pds_A 458 Irreversible Agonist-Beta2 Adrenoceptor Complex Len 3e-05
2r4s_A 342 Crystal Structure Of The Human Beta2 Adrenoceptor L 4e-05
2r4r_A 365 Crystal Structure Of The Human Beta2 Adrenoceptor L 5e-05
4gbr_A 309 N-terminal T4 Lysozyme Fusion Facilitates Crystalli 7e-05
>pdb|2Y00|B Chain B, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Partial Agonist Dobutamine (Crystal Dob92) Length = 315 Back     alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 4e-06, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 6 YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYTTSEHLKYR-YQHPNIC 64 Y AI P +Y MT+ ++ VW A++SF+PIM W+ + + YQ P C Sbjct: 110 YLAITSPFRYQSLMTRARAKVIICTVWAISALVSFLPIMMHWWRDEDPQALKCYQDPGCC 169 Query: 65 DF 66 DF Sbjct: 170 DF 171
>pdb|2VT4|A Chain A, Turkey Beta1 Adrenergic Receptor With Stabilising Mutations And Bound Cyanopindolol Length = 313 Back     alignment and structure
>pdb|3SN6|R Chain R, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 514 Back     alignment and structure
>pdb|3P0G|A Chain A, Structure Of A Nanobody-Stabilized Active State Of The Beta2 Adrenoceptor Length = 501 Back     alignment and structure
>pdb|2RH1|A Chain A, High Resolution Crystal Structure Of Human B2-Adrenergic G Protein- Coupled Receptor Length = 500 Back     alignment and structure
>pdb|3D4S|A Chain A, Cholesterol Bound Form Of Human Beta2 Adrenergic Receptor. Length = 490 Back     alignment and structure
>pdb|3KJ6|A Chain A, Crystal Structure Of A Methylated Beta2 Adrenergic Receptor- Fab Complex Length = 366 Back     alignment and structure
>pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458 Back     alignment and structure
>pdb|2R4S|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 342 Back     alignment and structure
>pdb|2R4R|A Chain A, Crystal Structure Of The Human Beta2 Adrenoceptor Length = 365 Back     alignment and structure
>pdb|4GBR|A Chain A, N-terminal T4 Lysozyme Fusion Facilitates Crystallization Of A G Protein Coupled Receptor Length = 309 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 6e-17
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 2e-16
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 2e-14
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 8e-14
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 1e-12
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 1e-12
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 3e-12
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 7e-10
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 4e-06
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A Length = 514 Back     alignment and structure
 Score = 72.6 bits (178), Expect = 6e-17
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 6   YYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWYT-TSEHLKYRYQHPNIC 64
           Y+AI  P KY   +TK     ++L VW+   + SF+PI   WY  T +     Y     C
Sbjct: 281 YFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCC 340

Query: 65  DF 66
           DF
Sbjct: 341 DF 342


>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Length = 500 Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Length = 315 Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Length = 488 Back     alignment and structure
>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Length = 467 Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Length = 447 Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Length = 452 Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, protein structure initiative, AC technologies center for gene to 3D structure; HET: ETQ MAL; 2.89A {Homo sapiens} Length = 481 Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Length = 520 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
4grv_A 510 Neurotensin receptor type 1, lysozyme chimera; G-p 98.73
3uon_A 467 Human M2 muscarinic acetylcholine, receptor T4 LY 98.6
4ea3_A 434 Fusion protein of nociceptin receptor and cytochr; 98.6
3v2y_A 520 Sphingosine 1-phosphate receptor 1, lysozyme CHIM; 98.6
2rh1_A 500 Beta-2-adrenergic receptor/T4-lysozyme chimera; GP 98.58
1u19_A 349 Rhodopsin; G protein-coupled receptor, membrane pr 98.57
4dkl_A 464 MU-type opioid receptor, lysozyme chimera; G-prote 98.56
3vw7_A 484 Proteinase-activated receptor 1, lysozyme; high re 98.56
3eml_A 488 Human adenosine A2A receptor/T4 lysozyme chimera; 98.52
3odu_A 502 C-X-C chemokine receptor type 4, lysozyme chimera; 98.52
2z73_A 448 Rhodopsin; visual pigment, GQ-type, G-protein coup 98.52
2ks9_A 364 Substance-P receptor; water, autodock, NK1, neurop 98.44
4eiy_A 447 Adenosine receptor A2A/soluble cytochrome B562 CH; 98.42
4amj_A 315 Beta-1 adrenergic receptor; membrane protein, 7TMR 98.42
2lnl_A 296 C-X-C chemokine receptor type 1; G protein coupled 98.41
3rze_A 452 Histamine H1 receptor, lysozyme chimera; structura 98.4
3sn6_R 514 Lysozyme, beta-2 adrenergic receptor; seven transm 98.29
3pbl_A 481 D(3) dopamine receptor, lysozyme chimera; structur 98.22
1hll_A32 Alpha-2A adrenergic receptor; helix-linker-helix, 98.0
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus} Back     alignment and structure
Probab=98.73  E-value=6.6e-10  Score=74.37  Aligned_cols=47  Identities=17%  Similarity=0.322  Sum_probs=42.3

Q ss_pred             CceeeEEeeecCCCCCceechhHHHHHHHHHhHHHHHHHhhhhhhccc
Q psy16678          1 MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIMCGWY   48 (87)
Q Consensus         1 is~dRy~~i~~pl~~~~~~~~~~~~~~~~~~Wv~~~~~~~~~~~~~~~   48 (87)
                      ||+|||+||++|++|...++++++..+++++|+++++.++|+++ .+.
T Consensus       131 is~dRy~ai~~P~~~~~~~t~~~~~~~i~~~W~~s~~~~~p~~~-~~~  177 (510)
T 4grv_A          131 LSVARYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLF-TMG  177 (510)
T ss_dssp             HHHHHHHHHHSCCCCCCCCCCSCCHHHHHHHHHHHHHHHTTHHH-HEE
T ss_pred             HHHHheEEEeccccccccccccccceeehHHHHHHHHHHHHHHH-hhc
Confidence            58899999999999999999999999999999999999999865 443



>3uon_A Human M2 muscarinic acetylcholine, receptor T4 LY fusion protein; G protein-coupled receptor, GPCR, SI protein-antagonist complex; HET: QNB BGC; 3.00A {Homo sapiens} PDB: 4daj_A* Back     alignment and structure
>3v2y_A Sphingosine 1-phosphate receptor 1, lysozyme CHIM; EDG receptor, lipid receptor, multiple sclerosi autoimmunity, structural genomics, PSI-biology; HET: ML5 NAG; 2.80A {Homo sapiens} PDB: 3v2w_A* Back     alignment and structure
>2rh1_A Beta-2-adrenergic receptor/T4-lysozyme chimera; GPCR, 7TM, fusion, lipidic cubic phase, lipidic, mesophase, cholesterol, membrane protein; HET: MAL CAU CLR PLM 12P; 2.40A {Homo sapiens} PDB: 3p0g_A* 3d4s_A* 3ny8_A* 3ny9_A* 3nya_A* 3pds_A* Back     alignment and structure
>1u19_A Rhodopsin; G protein-coupled receptor, membrane protein, retinal protei photoreceptor, signaling protein; HET: MAN NAG BMA RET PLM HTO HTG; 2.20A {Bos taurus} SCOP: f.13.1.2 PDB: 1hzx_A* 1gzm_A* 1l9h_A* 2g87_A* 2hpy_A* 2i35_A* 2i36_A* 2i37_A* 2ped_A* 3oax_A* 3c9l_A* 1jfp_A* 1ln6_A* 1f88_A* 3cap_A* 3dqb_A* 3pqr_A* 3pxo_A* 3c9m_A* 2x72_A* ... Back     alignment and structure
>4dkl_A MU-type opioid receptor, lysozyme chimera; G-protein coupled receptor, 7 transmembrane receptor, signal protein-antagonist complex; HET: BF0 CLR MPG 1PE; 2.80A {Mus musculus} PDB: 4ej4_A* 4djh_A* Back     alignment and structure
>3vw7_A Proteinase-activated receptor 1, lysozyme; high resolution structure, protease-activated receptor 1, in conformation, antagonist vorapaxar; HET: VPX OLC; 2.20A {Homo sapiens} Back     alignment and structure
>3eml_A Human adenosine A2A receptor/T4 lysozyme chimera; caffeine, GPCR, membrane protein, LCP, mesophase, structural genomics, PSI-2; HET: ZMA STE; 2.60A {Homo sapiens} PDB: 3qak_A* Back     alignment and structure
>3odu_A C-X-C chemokine receptor type 4, lysozyme chimera; structural genomics, PSI-2, protein structure initiative; HET: ITD OLC OLA; 2.50A {Homo sapiens} PDB: 3oe8_A* 3oe6_A* 3oe0_A* 3oe9_A* 2k03_B* 2k04_B 2k05_B* Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>2ks9_A Substance-P receptor; water, autodock, NK1, neuropeptide receptor-NEU complex; NMR {Homo sapiens} PDB: 2ksa_A 2ksb_A Back     alignment and structure
>4eiy_A Adenosine receptor A2A/soluble cytochrome B562 CH; novel protein engineering, GPCR network, PSI-biology, struct genomics, membrane protein, GPCR; HET: ZMA CLR OLA OLC OLB; 1.80A {Homo sapiens} PDB: 3vg9_A* 3vga_A* 2ydv_A* 2ydo_A* 3uza_A* 3rey_A* 3rfm_A* 3pwh_A* 3uzc_A* 4er9_A Back     alignment and structure
>4amj_A Beta-1 adrenergic receptor; membrane protein, 7TMR BETA1-adrenoceptor, stabilising mutat biased agonist; HET: CVD 2CV; 2.30A {Meleagris gallopavo} PDB: 2y01_A* 2y02_A* 2y03_A* 2y04_A* 4ami_A* 2y00_A* 2vt4_A* 2ycw_A* 2ycx_A* 2ycy_A* 2ycz_A* Back     alignment and structure
>2lnl_A C-X-C chemokine receptor type 1; G protein coupled receptor, GPCR, membrane protei transmembrane, 7TM, phospholipid, signaling, signaling PROT; NMR {Homo sapiens} Back     alignment and structure
>3rze_A Histamine H1 receptor, lysozyme chimera; structural genomics, PSI-biology, membrane protein, GPCR NET GPCR, hydrolase; HET: 5EH D7V OLC; 3.10A {Homo sapiens} Back     alignment and structure
>3sn6_R Lysozyme, beta-2 adrenergic receptor; seven transmembrane receptor, nanobody, G protein-coupled RE GPCR, signal transduction, G protein signaling; HET: P0G; 3.20A {Enterobacteria phage T4} PDB: 3kj6_A 2r4s_A 2r4r_A 4gbr_A* Back     alignment and structure
>3pbl_A D(3) dopamine receptor, lysozyme chimera; structural genomics, PSI-2, PSI-biology, protein structure initiative; HET: ETQ MAL; 2.89A {Homo sapiens} Back     alignment and structure
>1hll_A Alpha-2A adrenergic receptor; helix-linker-helix, membrane protein; NMR {Synthetic} SCOP: j.94.1.1 PDB: 1hof_A 1ho9_A 1hod_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1u19a_ 348 Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} 97.0
>d1u19a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Family A G protein-coupled receptor-like
superfamily: Family A G protein-coupled receptor-like
family: Rhodopsin-like
domain: Rhodopsin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=97.00  E-value=6.8e-05  Score=45.65  Aligned_cols=43  Identities=14%  Similarity=0.203  Sum_probs=32.9

Q ss_pred             CceeeEEeeecCCCCCceechhHHHHHHHHHhHHHHHHHhhhhh
Q psy16678          1 MLGHGYYAIVKPLKYPINMTKRVVAFMLLNVWVSPAVISFVPIM   44 (87)
Q Consensus         1 is~dRy~~i~~pl~~~~~~~~~~~~~~~~~~Wv~~~~~~~~~~~   44 (87)
                      +++|||.+|++|+++... +.++....+...|..+++...++.+
T Consensus       131 is~~R~~~i~~p~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~  173 (348)
T d1u19a_         131 LAIERYVVVCKPMSNFRF-GENHAIMGVAFTWVMALACAAPPLV  173 (348)
T ss_dssp             HHHHHHHHHTCCSSSCCC-CHHHHHHHHHHHHHHHHHHHSGGGT
T ss_pred             hhcccceeeecccccccc-ccccccccceeeehhhhheeccccc
Confidence            478999999999998765 5556666677778888777777744