Diaphorina citri psyllid: psy16684

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43

MANSLAIRFKTEGQTNNTVIEDVLRGRPGWMPVGSDDTNWDIFWCDLATTKLILESSMKNHQKIAHYRNFYEISRKNYLARNLKRYRRQCVKNGNTEEAELSNAMPMTFEIPSETALFLQEARRDSHNMWIVKPSGGSQGRGILLFKKLSEFEEWRENKDWSPKERKRSDDPNDIELIPEVYVAQKYITNPYLLEGRKFDMRMYVLVTSFSPLTVWIARDGFARIAGIKYCKDNFADNCMHLTNTAIQLSGENLSQGRKWDIQNLRLFLTAMHGREIVDELFQKIAKVVITALKSVECIMMGNKHCFELFGFDILLQDNLNVCLLEANAAPSMKATDDHDYKLKYNLIQDALNVIDLEKKLTGKEIRVGGFDKIWCGGPIYQINKGMNAPEFCKKSNFYNMYLGCVNDRDEQLEEMTKWMNILKKETVI

ccccEEEEEEEccccccHHHHHHHHcccccEEEccccccCEEEEccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccCCcccccccHHHHHHHHHHHcccccEEEEccccccccccEEEEcccHHHHHHHHccccccccccccccccccccccccEEEEEcccccccccccccEEEEEEEEccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccc

***SLAI*FKTEGQTNNTVIEDVLRGRPGWMPVGSDDTNWDIFWCDLATTKLILESSMKNHQKIAHYRNFYEISRKNYLARNLKRYRRQCVKNGNTEEAELSNAMPMTFEIPSETALFLQEARRDSHNMWIVKPSGGSQGRGILLFKKLSEFEEWR*******************ELIPEVYVAQKYITNPYLLEGRKFDMRMYVLVTSFSPLTVWIARDGFARIAGIKYCKDNFADNCMHLTNTAIQLSGENLSQGRKWDIQNLRLFLTAMHGREIVDELFQKIAKVVITALKSVECIMMGNKHCFELFGFDILLQDNLNVCLLEANAAPSMKATDDHDYKLKYNLIQDALNVIDLEKKLTGKEIRVGGFDKIWCGGPI*******NAPE*CKKSNFYNMYLGCVNDRDEQLEEMTKWMNIL******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable tubulin polyglutamylase TTLL9	Probable tubulin polyglutamylase that forms polyglutamate side chains on tubulin. Probably acts when complexed with other proteins.	confident	Q3SXZ7
Probable tubulin polyglutamylase TTLL9	Probable tubulin polyglutamylase that forms polyglutamate side chains on tubulin. Probably acts when complexed with other proteins.	confident	Q3SZH6
Probable tubulin polyglutamylase TTLL9	Probable tubulin polyglutamylase that forms polyglutamate side chains on tubulin. Probably acts when complexed with other proteins.	confident	Q641W7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0070740 [MF]	tubulin-glutamic acid ligase activity	probable	GO:0003824, GO:0070739, GO:0016881, GO:0016879, GO:0003674, GO:0016874
GO:0018095 [BP]	protein polyglutamylation	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0018200, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TIG, chain A
Confidence level:very confident
Coverage over the Query: 18-158,178-236,267-357
View the alignment between query and template
View the model in PyMOL