Diaphorina citri psyllid: psy16694


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
GHVLTAVNDAVIKNGQLDDGTDVLEFLSKPESFPVKLTFTRPRMTTNEKIFLASMFYPLFAIASQLSPEPKSSGIEVLEADTFKLHCYQTLTGVKFMIVGDTNQSGLDLILKKIYELYADYALKNPFYSLEMPIRCELFDTHLQNLLQQHEKTGVTNACGTLET
ccEEEEEcccccccccccccccEEEEccccccccEEccccccccccHHHHHHHHHHcccHHEEcccccccccccEEEEEEccEEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccccCCcHHHHHHHHHHHHHHHHcccccccccccc
GHVLTAVNDAVIKNGQLDDGTDVLEFLSKPESFPVKLTFTRPRMTTNEKIFLASMFYPLFAIASQLSPEPKSSGIEVLEADTFKLHCYQTLTGVKFMIVGDTNQSGLDLILKKIYELYADYALKNPFYSLEMPIRCELFDTHLQNLLQQHEKT***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GHVLTAVNDAVIKNGQLDDGTDVLEFLSKPESFPVKLTFTRPRMTTNEKIFLASMFYPLFAIASQLSPEPKSSGIEVLEADTFKLHCYQTLTGVKFMIVGDTNQSGLDLILKKIYELYADYALKNPFYSLEMPIRCELFDTHLQNLLQQHEKTGVTNACGTLET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trafficking protein particle complex subunit 4 May play a role in vesicular transport from endoplasmic reticulum to Golgi. May play a role in dendrite postsynaptic membrane trafficking.confidentQ9ES56
Trafficking protein particle complex subunit 4 May play a role in vesicular transport from endoplasmic reticulum to Golgi.confidentQ69BT7
Trafficking protein particle complex subunit 4 May play a role in vesicular transport from endoplasmic reticulum to Golgi.confidentQ2TBL9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016358 [BP]dendrite developmentprobableGO:0048666, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005795 [CC]Golgi stackprobableGO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0030008 [CC]TRAPP complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045212 [BP]neurotransmitter receptor biosynthetic processprobableGO:0019226, GO:0035637, GO:0032800, GO:0023052, GO:0044699, GO:1901576, GO:0044260, GO:0071704, GO:0032501, GO:0050877, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0044237, GO:0043170, GO:0045213, GO:0008150, GO:0043112
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005801 [CC]cis-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3T, chain D
Confidence level:very confident
Coverage over the Query: 1-157
View the alignment between query and template
View the model in PyMOL