Diaphorina citri psyllid: psy1670

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MADDAAKKAKQAEIDRKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKVS
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
*********************************************KLRLLL*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKAKKGFMTPERKKxxxxxxxxxxxxxxxxxxxxxVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Troponin I 4 Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to muscle actomyosin ATPase activity.confidentO44572
Troponin I Troponin I is the ATPase inhibitory subunit of troponin in the thin filament regulatory complex. Involved in the development and maintenance of muscle and nervous system. May also be involved in the cytoskeletal apparatus.confidentP36188

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007519 [BP]skeletal muscle tissue developmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0044767, GO:0061061, GO:0014706, GO:0048513, GO:0008150, GO:0060537, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0046716 [BP]muscle cell homeostasisprobableGO:0019725, GO:0060249, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699
GO:0000280 [BP]nuclear divisionprobableGO:0006996, GO:0071840, GO:0009987, GO:0016043, GO:0044763, GO:0048285, GO:0008150, GO:0044699
GO:0045214 [BP]sarcomere organizationprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0048738 [BP]cardiac muscle tissue developmentprobableGO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0072359, GO:0009888, GO:0044767, GO:0014706, GO:0072358, GO:0008150, GO:0060537, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YTZ, chain I
Confidence level:confident
Coverage over the Query: 34-67
View the alignment between query and template
View the model in PyMOL