Diaphorina citri psyllid: psy16725


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----
MRPILPIEEVDTEEEFTEEEEGECFFSVQNLSWNEGGDTNAMFQNLESPISENSAGKVYSSKPTSSNNYTLRRLVSKTGSCRVSKLNSSQHLPLFTAASDTFTSLIECRWRWVWTIFTLSFVLTWLLFAVGWWIIASKPTSSNNYTLRRLVSKTGSCRVSKLNSSQHLPLFTAASDTFTSLIECRWRWVWTIFTLSFVLTWLLFAVGWWIIAYHHGDLKTSPVRDPFNDTLPCVTGVDDFITSFLFSMETQYSTGYGSRIPNTHCPEAIFLVSIQSIFGVLINALTGGIIFAKLAKPKKRSQNLLFSDKAVICQRDGEYRLIWRIGDLRKSHLIGAKLRAWFLCRRMTREGEMIPRYKYKLNITVDDGGSSYLPSEIQWGHRFMPMFIKRDCKYYVDYARFQNTVLVNMPLCSAYQYEKLTRDALDLVEKKEKE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccEEEccccccccccEEcccccHHcccccHHHHHHHHHHHHHHHHHHHHHHEEECccccccccccccccEEccccccEEEEcccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccEEEEEEEEEcccccEEEEEEEEEEEEEEEEccccccccccCEEEEEEECcccccccccccEEccccccEEEcccccEEEEccccccEEEcccccccHHHHHHHHHHHHHHHHHHHcc
*************************FSVQ*L********************************************SKTGSCRVSKLNSSQHLPLFTAASDTFTSLIECRWRWVWTIFTLSFVLTWLLFAVGWWIIASKPTSSNNYTLRRLVSKTGSCRVSKLNSSQHLPLFTAASDTFTSLIECRWRWVWTIFTLSFVLTWLLFAVGWWIIAYHHGDLKTSPVRDPFNDTLPCVTGVDDFITSFLFSMETQYSTGYGSRIPNTHCPEAIFLVSIQSIFGVLINALTGGIIFAKLAKPKKRSQNLLFSDKAVICQRDGEYRLIWRIGDLRKSHLIGAKLRAWFLCRRMTREGEMIPRYKYKLNITVDDGGSSYLPSEIQWGHRFMPMFIKRDCKYYVDYARFQNTVLVNMPLCSAYQYEKLTRDALD********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPILPIEEVDTEEEFTEEEEGECFFSVQNLSWNEGGDTNAMFQNLESPISENSAGKVYSSKPTSSNNYTLRRLVSKTGSCRVSKLNSSQHLPLFTAASDTFTSLIECRWRWVWTIFTLSFVLTWLLFAVGWWIIASKPTSSNNYTLRRLVSKTGSCRVSKLNSSQHLPLFTAASDTFTSLIECRWRWVWTIFTLSFVLTWLLFAVGWWIIAYHHGDLKTSPVRDPFNDTLPCVTGVDDFITSFLFSMETQYSTGYGSRIPNTHCPEAIFLVSIQSIFGVLINALTGGIIFAKLAKPKKRSQNLLFSDKAVICQRDGEYRLIWRIGDLRKSHLIGAKLRAWFLCRRMTREGEMIPRYKYKLNITVDDGGSSYLPSEIQWGHRFMPMFIKRDCKYYVDYARFQNTVLVNMPLCSAYQYEKLTRDALDLVEKKEKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G protein-activated inward rectifier potassium channel 4 This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.confidentP48548
G protein-activated inward rectifier potassium channel 2 This potassium channel may be involved in the regulation of insulin secretion by glucose and/or neurotransmitters acting through G-protein-coupled receptors. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.confidentQ5NVJ6
G protein-activated inward rectifier potassium channel 4 This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.confidentP48544

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0030315 [CC]T-tubuleprobableGO:0042383, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0071805 [BP]potassium ion transmembrane transportprobableGO:0006810, GO:0071804, GO:0006813, GO:0006812, GO:0006811, GO:0009987, GO:0015672, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0030001, GO:0051179, GO:0051234, GO:0055085, GO:0044699
GO:0042391 [BP]regulation of membrane potentialprobableGO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005242 [MF]inward rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015276, GO:0022857, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0015077, GO:0015267, GO:0022836, GO:0005249, GO:0022834, GO:0022839, GO:0022838, GO:0015079

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U4F, chain A
Confidence level:very confident
Coverage over the Query: 289-421
View the alignment between query and template
View the model in PyMOL
Template: 3SPC, chain A
Confidence level:very confident
Coverage over the Query: 146-424
View the alignment between query and template
View the model in PyMOL
Template: 3SYA, chain A
Confidence level:very confident
Coverage over the Query: 71-143
View the alignment between query and template
View the model in PyMOL