Diaphorina citri psyllid: psy16743


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHEST
ccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHccccccccccHHHHHHHHHcc
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHEST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009165 [BP]nucleotide biosynthetic processprobableGO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0008150, GO:0071704, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:0044237, GO:0006796, GO:1901293, GO:0006793, GO:0019637, GO:0019438, GO:0006753
GO:0004137 [MF]deoxycytidine kinase activityprobableGO:0019206, GO:0019205, GO:0016772, GO:0019136, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009120 [BP]deoxyribonucleoside metabolic processprobableGO:0006139, GO:0044710, GO:0044238, GO:1901564, GO:0071704, GO:1901135, GO:0009987, GO:0006725, GO:0044237, GO:1901657, GO:0034641, GO:0006807, GO:1901360, GO:0009116, GO:0008152, GO:0008150, GO:0046483, GO:0055086, GO:0044281
GO:0072527 [BP]pyrimidine-containing compound metabolic processprobableGO:1901564, GO:0009987, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VP4, chain A
Confidence level:very confident
Coverage over the Query: 2-112
View the alignment between query and template
View the model in PyMOL