Psyllid ID: psy16743

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHEST
ccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHccccccccccHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHccccccccccHHHHHHHHHcc
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCpktvhermlkrnrpeencvpldylqslhest
mrwnfsfqHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHErmlkrnrpeencvpldylqslhest
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHEST
**WNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERM***********************
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHE**
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHEST
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLH*S*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHEST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q9XZT6250 Deoxynucleoside kinase OS yes N/A 0.973 0.444 0.459 5e-25
O00142265 Thymidine kinase 2, mitoc no N/A 0.964 0.415 0.436 8e-24
Q9N0C5265 Thymidine kinase 2, mitoc N/A N/A 0.964 0.415 0.427 4e-23
Q9R088270 Thymidine kinase 2, mitoc yes N/A 0.964 0.407 0.4 2e-21
Q3MHR2260 Deoxycytidine kinase OS=B no N/A 0.964 0.423 0.344 1e-14
P27707260 Deoxycytidine kinase OS=H no N/A 0.964 0.423 0.344 2e-14
P43346260 Deoxycytidine kinase OS=M no N/A 0.964 0.423 0.336 5e-14
P48769260 Deoxycytidine kinase OS=R no N/A 0.964 0.423 0.327 2e-13
Q9J579235 Probable deoxycytidine ki N/A N/A 0.973 0.472 0.327 2e-13
P21974219 Probable deoxycytidine ki N/A N/A 0.973 0.506 0.307 3e-13
>sp|Q9XZT6|DNK_DROME Deoxynucleoside kinase OS=Drosophila melanogaster GN=dnk PE=1 SV=1 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 74/111 (66%)

Query: 2   RWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSE 61
           +W   FQ YV LT LQ  T  T+KK+++ ERS+ + R+CFVE  R  G L +  +  + E
Sbjct: 75  KWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEE 134

Query: 62  WYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHE 112
           WY ++E ++ +  DLI+YLR+ P+  +ER+ +R R EE+CVPL YLQ LHE
Sbjct: 135 WYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHE 185
Deoxyribonucleoside kinase that has a broad specificity phosphorylating thymidine, deoxyadenosine, deoxycytidine and deoxyguanosine. Specificity is higher for pyrimidine nucleosides. Several anti-viral and anti-cancer nucleoside analogs are also efficiently phosphorylated.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 1EC: 4EC: 5
>sp|O00142|KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens GN=TK2 PE=1 SV=4 Back     alignment and function description
>sp|Q9N0C5|KITM_MACFA Thymidine kinase 2, mitochondrial OS=Macaca fascicularis GN=TK2 PE=2 SV=1 Back     alignment and function description
>sp|Q9R088|KITM_MOUSE Thymidine kinase 2, mitochondrial OS=Mus musculus GN=Tk2 PE=1 SV=2 Back     alignment and function description
>sp|Q3MHR2|DCK_BOVIN Deoxycytidine kinase OS=Bos taurus GN=DCK PE=2 SV=1 Back     alignment and function description
>sp|P27707|DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens GN=DCK PE=1 SV=1 Back     alignment and function description
>sp|P43346|DCK_MOUSE Deoxycytidine kinase OS=Mus musculus GN=Dck PE=1 SV=1 Back     alignment and function description
>sp|P48769|DCK_RAT Deoxycytidine kinase OS=Rattus norvegicus GN=Dck PE=2 SV=1 Back     alignment and function description
>sp|Q9J579|DCK2_FOWPN Probable deoxycytidine kinase FPV151 OS=Fowlpox virus (strain NVSL) GN=FPV151 PE=3 SV=1 Back     alignment and function description
>sp|P21974|DCK1_FOWPN Probable deoxycytidine kinase FPV059 OS=Fowlpox virus (strain NVSL) GN=FPV059 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
242247272 222 thymidine kinase-like [Acyrthosiphon pis 0.973 0.5 0.648 1e-37
270011851 221 hypothetical protein TcasGA2_TC005934 [T 0.982 0.506 0.556 2e-31
91088145 217 PREDICTED: similar to putative deoxynucl 0.982 0.516 0.556 3e-31
357606047 220 hypothetical protein KGM_19364 [Danaus p 0.973 0.504 0.561 1e-30
321466350 224 hypothetical protein DAPPUDRAFT_305834 [ 0.973 0.495 0.504 1e-29
242016715 260 Deoxynucleoside kinase, putative [Pedicu 0.973 0.426 0.491 1e-27
332376266 224 unknown [Dendroctonus ponderosae] 0.973 0.495 0.477 5e-26
157138694 248 thymidine kinase [Aedes aegypti] gi|1088 0.973 0.447 0.531 1e-25
157138696 261 thymidine kinase [Aedes aegypti] gi|1088 0.973 0.425 0.531 1e-25
321473657 236 hypothetical protein DAPPUDRAFT_99663 [D 0.973 0.470 0.495 1e-25
>gi|242247272|ref|NP_001156207.1| thymidine kinase-like [Acyrthosiphon pisum] gi|239790179|dbj|BAH71666.1| ACYPI006294 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 72/111 (64%), Positives = 88/111 (79%)

Query: 2   RWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSE 61
           RWNF+FQH VQL+RL +Q+K T+K +Q+FERSLQNNR+CFVEMA  +G LS  E+  M +
Sbjct: 63  RWNFAFQHNVQLSRLNLQSKTTNKDIQMFERSLQNNRYCFVEMAHDKGLLSSPEYGVMCQ 122

Query: 62  WYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHE 112
           WY+++E N+DIGLDLIVYLRS P  VH RM +RNRPEE  V LDYL  LHE
Sbjct: 123 WYEYIETNVDIGLDLIVYLRSLPDIVHTRMQRRNRPEERTVKLDYLIDLHE 173

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270011851|gb|EFA08299.1| hypothetical protein TcasGA2_TC005934 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91088145|ref|XP_971294.1| PREDICTED: similar to putative deoxynucleoside kinase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357606047|gb|EHJ64893.1| hypothetical protein KGM_19364 [Danaus plexippus] Back     alignment and taxonomy information
>gi|321466350|gb|EFX77346.1| hypothetical protein DAPPUDRAFT_305834 [Daphnia pulex] Back     alignment and taxonomy information
>gi|242016715|ref|XP_002428893.1| Deoxynucleoside kinase, putative [Pediculus humanus corporis] gi|212513661|gb|EEB16155.1| Deoxynucleoside kinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332376266|gb|AEE63273.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|157138694|ref|XP_001657341.1| thymidine kinase [Aedes aegypti] gi|108869443|gb|EAT33668.1| AAEL014055-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|157138696|ref|XP_001657342.1| thymidine kinase [Aedes aegypti] gi|108869444|gb|EAT33669.1| AAEL014055-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|321473657|gb|EFX84624.1| hypothetical protein DAPPUDRAFT_99663 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
FB|FBgn0022338250 dnk "deoxyribonucleoside kinas 0.973 0.444 0.459 2e-24
UNIPROTKB|F1MNI9305 TK2 "Uncharacterized protein" 0.964 0.360 0.436 6.8e-24
UNIPROTKB|B4DZK7168 TK2 "cDNA FLJ59102, highly sim 0.964 0.654 0.436 8.7e-24
UNIPROTKB|E5KNQ5307 TK2 "Mitochondrial thymidine k 0.964 0.358 0.436 8.7e-24
UNIPROTKB|F5GYK4216 TK2 "Thymidine kinase 2, mitoc 0.964 0.509 0.436 8.7e-24
UNIPROTKB|J3KS73130 TK2 "Thymidine kinase 2, mitoc 0.964 0.846 0.436 8.7e-24
UNIPROTKB|O00142265 TK2 "Thymidine kinase 2, mitoc 0.964 0.415 0.436 8.7e-24
UNIPROTKB|Q5ZI21168 TK2 "Uncharacterized protein" 0.973 0.660 0.387 6.1e-23
UNIPROTKB|F1P6V1227 TK2 "Uncharacterized protein" 0.964 0.484 0.409 2.6e-22
MGI|MGI:1913266270 Tk2 "thymidine kinase 2, mitoc 0.964 0.407 0.4 2.4e-21
FB|FBgn0022338 dnk "deoxyribonucleoside kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 279 (103.3 bits), Expect = 2.0e-24, P = 2.0e-24
 Identities = 51/111 (45%), Positives = 74/111 (66%)

Query:     2 RWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSE 61
             +W   FQ YV LT LQ  T  T+KK+++ ERS+ + R+CFVE  R  G L +  +  + E
Sbjct:    75 KWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEE 134

Query:    62 WYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHE 112
             WY ++E ++ +  DLI+YLR+ P+  +ER+ +R R EE+CVPL YLQ LHE
Sbjct:   135 WYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHE 185
GO:0019136 "deoxynucleoside kinase activity" evidence=IDA;NAS
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=IDA
GO:0016310 "phosphorylation" evidence=NAS
GO:0006230 "TMP biosynthetic process" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS
GO:0004797 "thymidine kinase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0046939 "nucleotide phosphorylation" evidence=IDA
GO:0016301 "kinase activity" evidence=IDA
UNIPROTKB|F1MNI9 TK2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DZK7 TK2 "cDNA FLJ59102, highly similar to Thymidine kinase 2, mitochondrial (EC 2.7.1.21)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5KNQ5 TK2 "Mitochondrial thymidine kinase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GYK4 TK2 "Thymidine kinase 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KS73 TK2 "Thymidine kinase 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O00142 TK2 "Thymidine kinase 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZI21 TK2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6V1 TK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913266 Tk2 "thymidine kinase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
cd01673193 cd01673, dNK, Deoxyribonucleoside kinase (dNK) cat 7e-28
pfam01712146 pfam01712, dNK, Deoxynucleoside kinase 4e-23
COG1428216 COG1428, COG1428, Deoxynucleoside kinases [Nucleot 1e-08
cd02030219 cd02030, NDUO42, NADH:Ubiquinone oxioreductase, 42 7e-06
TIGR00213176 TIGR00213, GmhB_yaeD, D,D-heptose 1,7-bisphosphate 0.002
PHA03132 580 PHA03132, PHA03132, thymidine kinase; Provisional 0.002
PRK08942181 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate p 0.002
>gnl|CDD|238836 cd01673, dNK, Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information 
 Score =  100 bits (251), Expect = 7e-28
 Identities = 39/115 (33%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 2   RWNFSFQHYVQLTRLQMQTKV----TDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFL 57
           RW F FQ Y  L+RL+         +  +  + ERS+ ++R         +G + K E+ 
Sbjct: 51  RWAFPFQLYFLLSRLKQYKDALEHLSTGQGVILERSIFSDRVFAEAN-LKEGGIMKTEYD 109

Query: 58  AMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHE 112
             +E +D +   +    DL++YL + P+T  +R+ KR RPEE  +PLDYL+ LHE
Sbjct: 110 LYNELFDNLIPELLP-PDLVIYLDASPETCLKRIKKRGRPEEQGIPLDYLEDLHE 163

This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA. Length = 193
>gnl|CDD|216657 pfam01712, dNK, Deoxynucleoside kinase Back     alignment and domain information
>gnl|CDD|224345 COG1428, COG1428, Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|238988 cd02030, NDUO42, NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>gnl|CDD|129317 TIGR00213, GmhB_yaeD, D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|236354 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG4235|consensus244 100.0
PF01712146 dNK: Deoxynucleoside kinase; InterPro: IPR002624 T 100.0
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 99.97
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 99.93
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 99.91
KOG3877|consensus 393 99.89
PHA03132 580 thymidine kinase; Provisional 99.72
PHA03136 378 thymidine kinase; Provisional 99.63
PRK07933213 thymidylate kinase; Validated 99.54
PHA03138 340 thymidine kinase; Provisional 99.48
PRK13976209 thymidylate kinase; Provisional 99.39
PHA03134 340 thymidine kinase; Provisional 99.28
PLN02924220 thymidylate kinase 99.27
PRK00698205 tmk thymidylate kinase; Validated 99.26
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 99.26
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 99.26
PRK13974212 thymidylate kinase; Provisional 99.18
PHA03135 343 thymidine kinase; Provisional 99.13
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 99.12
PRK13975196 thymidylate kinase; Provisional 99.08
PRK13973213 thymidylate kinase; Provisional 99.07
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 99.0
PF00693281 Herpes_TK: Thymidine kinase from herpesvirus; Inte 98.76
PHA03133 368 thymidine kinase; Provisional 98.35
KOG3327|consensus208 98.23
PRK04040188 adenylate kinase; Provisional 97.28
PRK06762166 hypothetical protein; Provisional 97.06
PRK14532188 adenylate kinase; Provisional 97.0
PRK02496184 adk adenylate kinase; Provisional 96.94
PRK13949169 shikimate kinase; Provisional 96.88
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.87
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.71
PRK14531183 adenylate kinase; Provisional 96.7
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.69
KOG3079|consensus195 96.44
PRK14527191 adenylate kinase; Provisional 96.22
PRK08118167 topology modulation protein; Reviewed 96.22
PRK13808 333 adenylate kinase; Provisional 96.18
PRK14528186 adenylate kinase; Provisional 96.08
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 96.02
PRK06217183 hypothetical protein; Validated 95.59
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 95.56
PRK03839180 putative kinase; Provisional 95.56
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.52
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.47
PLN02200234 adenylate kinase family protein 95.36
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 95.17
PRK08356195 hypothetical protein; Provisional 95.16
PRK08233182 hypothetical protein; Provisional 95.01
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 94.73
PRK04182180 cytidylate kinase; Provisional 94.56
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.45
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 94.4
PRK14530215 adenylate kinase; Provisional 94.3
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 94.26
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.2
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 94.14
PRK06761282 hypothetical protein; Provisional 94.05
COG4088 261 Predicted nucleotide kinase [Nucleotide transport 93.63
TIGR03707230 PPK2_P_aer polyphosphate kinase 2, PA0141 family. 93.58
PRK00625173 shikimate kinase; Provisional 93.55
PLN02842 505 nucleotide kinase 93.42
PRK14734200 coaE dephospho-CoA kinase; Provisional 93.2
PRK01184184 hypothetical protein; Provisional 93.08
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.99
PRK00279215 adk adenylate kinase; Reviewed 92.88
PRK14731208 coaE dephospho-CoA kinase; Provisional 92.78
PRK05057172 aroK shikimate kinase I; Reviewed 92.7
TIGR03575 340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 92.69
TIGR03709264 PPK2_rel_1 polyphosphate:nucleotide phosphotransfe 92.59
PRK14529223 adenylate kinase; Provisional 92.41
PRK00081194 coaE dephospho-CoA kinase; Reviewed 92.36
PRK13946184 shikimate kinase; Provisional 92.34
PF03976228 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR 92.3
PLN02674244 adenylate kinase 92.28
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.28
PRK03731171 aroL shikimate kinase II; Reviewed 91.95
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 91.93
PRK09825176 idnK D-gluconate kinase; Provisional 91.78
PRK06547172 hypothetical protein; Provisional 91.71
TIGR03708 493 poly_P_AMP_trns polyphosphate:AMP phosphotransfera 91.64
COG2326270 Uncharacterized conserved protein [Function unknow 91.54
PRK14732196 coaE dephospho-CoA kinase; Provisional 91.53
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 91.51
PRK11545163 gntK gluconate kinase 1; Provisional 91.24
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 91.1
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 90.71
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 90.68
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 90.59
PRK06696223 uridine kinase; Validated 90.45
TIGR00152188 dephospho-CoA kinase. This model produces scores i 90.44
COG4639168 Predicted kinase [General function prediction only 90.41
PRK05480209 uridine/cytidine kinase; Provisional 90.3
PRK09270229 nucleoside triphosphate hydrolase domain-containin 90.23
PRK14730195 coaE dephospho-CoA kinase; Provisional 89.88
TIGR03708493 poly_P_AMP_trns polyphosphate:AMP phosphotransfera 89.86
KOG3347|consensus176 89.78
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 89.76
PRK05541176 adenylylsulfate kinase; Provisional 89.59
PLN02422232 dephospho-CoA kinase 89.03
PRK14738206 gmk guanylate kinase; Provisional 88.97
PRK13948182 shikimate kinase; Provisional 88.9
PRK13947171 shikimate kinase; Provisional 88.71
COG0703172 AroK Shikimate kinase [Amino acid transport and me 88.58
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 88.46
PRK07667193 uridine kinase; Provisional 87.16
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 87.13
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 87.01
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 86.95
PRK08154309 anaerobic benzoate catabolism transcriptional regu 86.63
PRK00131175 aroK shikimate kinase; Reviewed 86.61
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 86.4
PHA02530 300 pseT polynucleotide kinase; Provisional 86.2
TIGR00235207 udk uridine kinase. Model contains a number of lon 85.69
PRK07261171 topology modulation protein; Provisional 85.64
PTZ00301210 uridine kinase; Provisional 85.45
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 84.42
PTZ00451244 dephospho-CoA kinase; Provisional 84.18
PLN02459261 probable adenylate kinase 84.04
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 83.89
PTZ00088229 adenylate kinase 1; Provisional 83.4
COG3709192 Uncharacterized component of phosphonate metabolis 83.0
PRK03333 395 coaE dephospho-CoA kinase/protein folding accessor 82.65
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 82.26
PRK14733204 coaE dephospho-CoA kinase; Provisional 81.66
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 81.21
>KOG4235|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.8e-37  Score=217.52  Aligned_cols=113  Identities=42%  Similarity=0.811  Sum_probs=108.3

Q ss_pred             CccchHHHHHHHHHHHHHHHhhhcC--CcccccccccccHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHhhcccCCCEEE
Q psy16743          1 MRWNFSFQHYVQLTRLQMQTKVTDK--KVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIV   78 (114)
Q Consensus         1 ~r~~~~~Q~~~l~~R~~~~~~~~~~--~~~i~eRs~~sd~~vF~~~~~~~g~~~~~e~~~y~~~~~~~~~~~~~~pdl~I   78 (114)
                      .||||+||.|++++|+++++...++  ++.+||||++||||||++++|++|.|++.|+.+|.+|++++.......||++|
T Consensus        79 ~Rws~tfQtYv~ltrL~~~~~p~~~~kpvrimERSv~SdRyiFv~nl~esg~m~e~e~~iy~eW~d~i~~~~~v~~dgiI  158 (244)
T KOG4235|consen   79 ARWSYTFQTYVFLTRLKVQLEPFNGRKPVRIMERSVYSDRYIFVENLYESGSMNEVEYVIYQEWFDWILRSMDVSLDGII  158 (244)
T ss_pred             HhheehhhHHHHHHHHHHHhcCCCCCCCeehhhhhhhhhHHHHHHHHHhcCCcccchhhhHHHHHHHHHhccccccceEE
Confidence            4899999999999999999998775  89999999999999999999999999999999999999999988778999999


Q ss_pred             EEecCHHHHHHHHHhcCCccccCCcHHHHHHHHhc
Q psy16743         79 YLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHES  113 (114)
Q Consensus        79 yL~~~pe~~~~Ri~~Rgr~~E~~i~~~Yl~~l~~~  113 (114)
                      ||+++||+|++||.+|+|.+|++|+++||+.||..
T Consensus       159 YLrasPetc~~Ri~~R~R~EE~gipL~YLe~LH~~  193 (244)
T KOG4235|consen  159 YLRASPETCYKRIYLRAREEEKGIPLKYLEALHEL  193 (244)
T ss_pred             EeecChHHHHHHHHHHhhhhhcCCcHHHHHHHHHH
Confidence            99999999999999999999999999999999963

>PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>KOG3877|consensus Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PHA03136 thymidine kinase; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PHA03138 thymidine kinase; Provisional Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PHA03134 thymidine kinase; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PHA03135 thymidine kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PF00693 Herpes_TK: Thymidine kinase from herpesvirus; InterPro: IPR001889 The thymidine kinase from Herpesviridae catalyses the reaction: ATP + THYMIDINE = ADP + THYMIDINE 5'-PHOSPHATE Back     alignment and domain information
>PHA03133 thymidine kinase; Provisional Back     alignment and domain information
>KOG3327|consensus Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3079|consensus Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF03976 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR022488 This presumed domain is found in one or two copies per protein Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase Back     alignment and domain information
>COG2326 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1ot3_A250 Crystal Structure Of Drosophila Deoxyribonucleotide 4e-26
1zmx_A230 Crystal Structure Of D. Melanogaster Deoxyribonucle 4e-26
1j90_A230 Crystal Structure Of Drosophila Deoxyribonucleoside 4e-26
2jcs_A230 Active Site Mutant Of Dnk From D. Melanogaster With 4e-26
2zi3_A279 C4s-E247a Dck Variant Of Dck In Complex With D-Da+a 1e-15
3qej_A279 S74e-Dck Mutant In Complex With Udp Length = 279 1e-15
2zi4_A279 C4s Dck Variant Of Dck In Complex With L-Da+adp Len 1e-15
2no9_A280 The Structure Of Deoxycytidine Kinase Complexed Wit 1e-15
1p5z_B263 Structure Of Human Dck Complexed With Cytarabine An 1e-15
2a2z_A248 Crystal Structure Of Human Deoxycytidine Kinase In 1e-15
2qrn_A280 Human Deoxycytidine Kinase Dcmp, Udp, Mg Ion Produc 1e-15
3ipx_A241 X-Ray Structure Of Human Deoxycytidine Kinase In Co 2e-15
3qeo_A279 S74e-R104m-D133a Dck Variant In Complex With L-Deox 4e-15
3hp1_A280 Crystal Structure Of Human Dck R104mD133A IN COMPLE 5e-15
2ocp_A241 Crystal Structure Of Human Deoxyguanosine Kinase Le 3e-11
>pdb|1OT3|A Chain A, Crystal Structure Of Drosophila Deoxyribonucleotide Kinase Complexed With The Substrate Deoxythymidine Length = 250 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (281), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 74/111 (66%)
Query: 2   RWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSE 61
           +W   FQ YV LT LQ  T  T+KK+++ ERS+ + R+CFVE  R  G L +  +  + E
Sbjct: 75  KWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEE 134
Query: 62  WYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHE 112
           WY ++E ++ +  DLI+YLR+ P+  +ER+ +R R EE+CVPL YLQ LHE
Sbjct: 135 WYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHE 185
>pdb|1ZMX|A Chain A, Crystal Structure Of D. Melanogaster Deoxyribonucleoside Kinase N64d Mutant In Complex With Thymidine Length = 230 Back     alignment and structure
>pdb|1J90|A Chain A, Crystal Structure Of Drosophila Deoxyribonucleoside Kinase Length = 230 Back     alignment and structure
>pdb|2JCS|A Chain A, Active Site Mutant Of Dnk From D. Melanogaster With Dttp Bound Length = 230 Back     alignment and structure
>pdb|2ZI3|A Chain A, C4s-E247a Dck Variant Of Dck In Complex With D-Da+adp Length = 279 Back     alignment and structure
>pdb|3QEJ|A Chain A, S74e-Dck Mutant In Complex With Udp Length = 279 Back     alignment and structure
>pdb|2ZI4|A Chain A, C4s Dck Variant Of Dck In Complex With L-Da+adp Length = 279 Back     alignment and structure
>pdb|2NO9|A Chain A, The Structure Of Deoxycytidine Kinase Complexed With Troxacitabine And Adp. Length = 280 Back     alignment and structure
>pdb|1P5Z|B Chain B, Structure Of Human Dck Complexed With Cytarabine And Adp-Mg Length = 263 Back     alignment and structure
>pdb|2A2Z|A Chain A, Crystal Structure Of Human Deoxycytidine Kinase In Complex With Deoxycytidine And Uridine Diphosphate Length = 248 Back     alignment and structure
>pdb|2QRN|A Chain A, Human Deoxycytidine Kinase Dcmp, Udp, Mg Ion Product Complex Length = 280 Back     alignment and structure
>pdb|3IPX|A Chain A, X-Ray Structure Of Human Deoxycytidine Kinase In Complex With Adp And An Inhibitor Length = 241 Back     alignment and structure
>pdb|3QEO|A Chain A, S74e-R104m-D133a Dck Variant In Complex With L-Deoxythymidine And Udp Length = 279 Back     alignment and structure
>pdb|3HP1|A Chain A, Crystal Structure Of Human Dck R104mD133A IN COMPLEX WITH L-Dt And Adp Length = 280 Back     alignment and structure
>pdb|2OCP|A Chain A, Crystal Structure Of Human Deoxyguanosine Kinase Length = 241 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1p6x_A 334 Thymidine kinase; P-loop, LID, transferase; HET: T 3e-25
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 4e-25
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 6e-24
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 3e-22
1osn_A 341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 4e-21
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 3e-20
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 3e-19
1e2k_A 331 Thymidine kinase; transferase, antiviral drug, enz 3e-18
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Length = 334 Back     alignment and structure
 Score = 96.0 bits (238), Expect = 3e-25
 Identities = 17/125 (13%), Positives = 31/125 (24%), Gaps = 19/125 (15%)

Query: 2   RWNFSFQHYVQLTRLQMQTKV-------------TDKKVQLFERSLQNNRFCFVEMARAQ 48
                +Q       L +                       +F+R    +  CF       
Sbjct: 78  LITAHYQSRFTTPYLILHDHTCTLFGGNSLQRGTQPDLTLVFDRHPVASTVCFPAARYLL 137

Query: 49  GFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQ 108
           G +S    +AM           +     IV      +    R+  R R  E  + +  + 
Sbjct: 138 GDMSMCALMAMVATL-----PREPQGGNIVVTTLNVEEHIRRLRTRARIGEQ-IDITLIA 191

Query: 109 SLHES 113
           +L   
Sbjct: 192 TLRNV 196
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Length = 230 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Length = 241 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Length = 263 Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Length = 341 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Length = 205 Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Length = 376 Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Length = 331 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 99.83
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 99.81
1p6x_A 334 Thymidine kinase; P-loop, LID, transferase; HET: T 99.76
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 99.73
1osn_A 341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 99.65
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 99.65
1e2k_A 331 Thymidine kinase; transferase, antiviral drug, enz 99.65
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 99.64
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 99.53
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 99.52
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 99.42
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 99.41
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 99.39
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 99.38
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 99.34
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 99.16
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 99.09
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.8
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.68
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 98.53
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.52
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.52
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.14
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 98.1
3czq_A304 Putative polyphosphate kinase 2; structural genomi 97.96
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 97.7
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.61
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.57
3czp_A 500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 97.53
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 97.44
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.28
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.26
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.18
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.88
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.87
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.83
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.8
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.66
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.51
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.48
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.43
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.43
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.4
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.39
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.37
3rhf_A289 Putative polyphosphate kinase 2 family protein; PS 96.35
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.31
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.26
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.23
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.21
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.2
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.08
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 95.93
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.92
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.89
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.88
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.84
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.83
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.8
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.66
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.64
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 95.58
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.58
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.54
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.49
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 95.41
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.34
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.3
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 95.27
2vli_A183 Antibiotic resistance protein; transferase, tunica 95.26
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.09
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.01
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.95
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.84
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 94.72
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 94.53
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.29
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.81
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 93.63
1via_A175 Shikimate kinase; structural genomics, transferase 93.62
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 93.57
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.35
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.28
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.06
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 92.31
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.12
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 91.92
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.61
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 91.45
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 91.01
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.72
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 90.54
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 89.63
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 87.87
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 87.82
1kag_A173 SKI, shikimate kinase I; transferase, structural g 87.64
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 87.64
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 85.1
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 83.72
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 83.33
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 82.61
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 82.37
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 81.46
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 81.3
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
Probab=99.83  E-value=6.2e-20  Score=130.89  Aligned_cols=111  Identities=33%  Similarity=0.626  Sum_probs=96.9

Q ss_pred             ccchHHHHHHHHHHHHHHHhhh-------cCCcccccccccccHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHhhcc--c
Q psy16743          2 RWNFSFQHYVQLTRLQMQTKVT-------DKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMD--I   72 (114)
Q Consensus         2 r~~~~~Q~~~l~~R~~~~~~~~-------~~~~~i~eRs~~sd~~vF~~~~~~~g~~~~~e~~~y~~~~~~~~~~~~--~   72 (114)
                      +|+|.+|+++++.|++++....       ..+..+.||++++|+|+|+..+|+.|.+++.++..|.+|+.++...+.  +
T Consensus        69 ~~~~~~~~~~ll~r~~~~~~~~~~~~~~~~~~~l~~~r~vi~Dr~~~s~~~y~~~~~~~~e~~~~~~~~~~l~~~~~~~~  148 (241)
T 2ocp_A           69 RWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIFERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFASRI  148 (241)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCCCHHHHSCSSCEEEEESCHHHHHHTHHHHHHHTTSSCHHHHHHHHHHHHHHHHHSHHHH
T ss_pred             cchhHHHHHHHHHHHHHHHHHHhhhhcccCCceEeeeCCchhhHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHhccccc
Confidence            5789999999999999865432       244678999999999999999999999999999999999999877651  4


Q ss_pred             CCCEEEEEecCHHHHHHHHHhcCCccccCCcHHHHHHHHh
Q psy16743         73 GLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQSLHE  112 (114)
Q Consensus        73 ~pdl~IyL~~~pe~~~~Ri~~Rgr~~E~~i~~~Yl~~l~~  112 (114)
                      .||++|||++||+++++|+.+|||..|...+.+|++.+++
T Consensus       149 ~pd~~i~l~~~~~~~~~R~~~R~r~~e~~~~~~~~~~v~~  188 (241)
T 2ocp_A          149 TLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHG  188 (241)
T ss_dssp             CCCEEEEEECCHHHHHHHHHHSCCTTTTTCCHHHHHHHHH
T ss_pred             CCCEEEEEECCHHHHHHHHHhcCCcccccCCHHHHHHHHH
Confidence            8999999999999999999999999888777899998875
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1p6xa_ 333 c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus 9e-20
d1e2ka_ 329 c.37.1.1 (A:) Thymidine kinase {Herpes simplex vir 2e-17
d1osna_ 331 c.37.1.1 (A:) Thymidine kinase {Varicella-zoster v 2e-16
d2vp4a1197 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fr 6e-15
d2ocpa1241 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human ( 3e-11
d1p5zb_241 c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sa 7e-09
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Length = 333 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidine kinase
species: Equine herpesvirus type 4 [TaxId: 10331]

 Score = 80.0 bits (197), Expect = 9e-20
 Identities = 17/125 (13%), Positives = 31/125 (24%), Gaps = 19/125 (15%)

Query: 2   RWNFSFQHYVQLTRLQMQT-------------KVTDKKVQLFERSLQNNRFCFVEMARAQ 48
                +Q       L +                       +F+R    +  CF       
Sbjct: 77  LITAHYQSRFTTPYLILHDHTCTLFGGNSLQRGTQPDLTLVFDRHPVASTVCFPAARYLL 136

Query: 49  GFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLRSCPKTVHERMLKRNRPEENCVPLDYLQ 108
           G +S    +AM           +     IV      +    R+  R R  E  + +  + 
Sbjct: 137 GDMSMCALMAMVATLPR-----EPQGGNIVVTTLNVEEHIRRLRTRARIGEQ-IDITLIA 190

Query: 109 SLHES 113
           +L   
Sbjct: 191 TLRNV 195
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Length = 329 Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Length = 331 Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 197 Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 99.9
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 99.89
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 99.86
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 99.85
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 99.83
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 99.81
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 99.52
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 99.47
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 99.26
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 99.14
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 97.97
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.36
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.22
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.18
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.87
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.73
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.64
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.6
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.54
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.29
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.96
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.84
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.42
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.22
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.61
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.34
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.06
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.96
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.45
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.39
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.18
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.03
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.84
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.64
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.02
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 89.67
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.46
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 89.32
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.34
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 86.65
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 83.0
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 82.04
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 80.42
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxyribonucleoside kinase
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.90  E-value=7.1e-24  Score=144.92  Aligned_cols=112  Identities=46%  Similarity=0.874  Sum_probs=104.7

Q ss_pred             ccchHHHHHHHHHHHHHHHhhhcCCcccccccccccHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHhhcccCCCEEEEEe
Q psy16743          2 RWNFSFQHYVQLTRLQMQTKVTDKKVQLFERSLQNNRFCFVEMARAQGFLSKQEFLAMSEWYDWVENNMDIGLDLIVYLR   81 (114)
Q Consensus         2 r~~~~~Q~~~l~~R~~~~~~~~~~~~~i~eRs~~sd~~vF~~~~~~~g~~~~~e~~~y~~~~~~~~~~~~~~pdl~IyL~   81 (114)
                      +|+|++|.+++..+..++......+..+.+|++++|+++|+..+++.+.+...+...|..+++.+...+.+.||++|||+
T Consensus        64 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pdl~i~Ld  143 (197)
T d2vp4a1          64 KWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLR  143 (197)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCCCSSEEEEESCHHHHHHTHHHHHHHHTSSCHHHHHHHHHHHHHHHHHBCCCCSEEEEEE
T ss_pred             cccchHHHHHHHHHHHHHHHHhcccccccCceeecchHHHHHHHHHhccCChhHHHHHHHHHHHHHhhcccccchhheee
Confidence            58899999999999999988877778999999999999999999999999999999999999988877668899999999


Q ss_pred             cCHHHHHHHHHhcCCccccCCcHHHHHHHHhc
Q psy16743         82 SCPKTVHERMLKRNRPEENCVPLDYLQSLHES  113 (114)
Q Consensus        82 ~~pe~~~~Ri~~Rgr~~E~~i~~~Yl~~l~~~  113 (114)
                      +||++|++||++|||++|..++.+||+.||+.
T Consensus       144 ~~~~~~~~Ri~~R~r~~E~~i~~~yl~~l~~~  175 (197)
T d2vp4a1         144 TSPEVAYERIRQRARSEESCVPLKYLQELHEL  175 (197)
T ss_dssp             CCHHHHHHHHHHHCCGGGTTCCHHHHHHHHHH
T ss_pred             cCHHHHHHHHHHhCchhhhcCCHHHHHHHHHH
Confidence            99999999999999999999999999999863
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure