Diaphorina citri psyllid: psy16748

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MNSDCTSCGKKIEISNFPPTLHAHEGCLKLPHHFPHAQRQERPRMAYLSPVHKHTLKTLKILVRMASSGYRIEADTFGELQVPNDKYYGAQTVRSTINFPIGGETERMPLPVITAMGTLKKAAAQVNKEFGLDAKVADAISKAADEVISGKLYAEHFPLVIWQTGSGTQTNMNTNEVISNRAIEILGKNTVLGWFSQNGERLLFLPIADFWQLLNPYLDRRNKKNVDENVLNLSSAGSSDSEEGEEGGGWDFVQGGQDARTLATHTSHTVTVSAKLKIFDTHFTFHVQMTK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccccHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHccccccccHHHHHcccccccccccccccccEEEEcccccccccccccEEEEEEEEEEEEEcEEEEEEEEcc
********GKKIEISNFPPTLHAHEGCLKLPHHF**********MAYLSPVHKHTLKTLKILVRMASSGYRIEADTFGELQVPNDKYYGAQTVRSTINFPIGGETERMPLPVITAMGTLKKAAAQVNKEFGLDAKVADAISKAADEVISGKLYAEHFPLVIWQTGSGTQTNMNTNEVISNRAIEILGKNTVLGW**QNGERLLFLPIADFWQLLNPYLDR*****************************WDFVQGGQDARTLATHTSHTVTVSAKLKIFDTHFTFHVQMT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSDCTSCGKKIEISNFPPTLHAHEGCLKLPHHFPHAQRQERPRMAYLSPVHKHTLKTLKILVRMASSGYRIEADTFGELQVPNDKYYGAQTVRSTINFPIGGETERMPLPVITAMGTLKKAAAQVNKEFGLDAKVADAISKAADEVISGKLYAEHFPLVIWQTGSGTQTNMNTNEVISNRAIEILGKNTVLGWFSQNGERLLFLPIADFWQLLNPYLDRRNKKNVDENVLNLSSAGSSDSEEGEEGGGWDFVQGGQDARTLATHTSHTVTVSAKLKIFDTHFTFHVQMTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Fumarate hydratase, mitochondrial confidentP14408
Fumarate hydratase, mitochondrial Also acts as a tumor suppressor.confidentP07954
Fumarate hydratase, mitochondrial confidentP10173

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004333 [MF]fumarate hydratase activityprobableGO:0016835, GO:0016836, GO:0003674, GO:0016829, GO:0003824
GO:0006108 [BP]malate metabolic processprobableGO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0048873 [BP]homeostasis of number of cells within a tissueprobableGO:0032501, GO:0048872, GO:0044707, GO:0060249, GO:0048871, GO:0042592, GO:0065007, GO:0008150, GO:0001894, GO:0065008, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0045239 [CC]tricarboxylic acid cycle enzyme complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006106 [BP]fumarate metabolic processprobableGO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0006099 [BP]tricarboxylic acid cycleprobableGO:0044238, GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0009060, GO:0008150, GO:0008152, GO:0045333, GO:0006091, GO:0055114
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GTD, chain A
Confidence level:very confident
Coverage over the Query: 69-246
View the alignment between query and template
View the model in PyMOL