Diaphorina citri psyllid: psy16754


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MFRLVGEESFQLDSKVPCLIKIEPSGPFGYAYSITVDGKTLEKFSQSKANCTWIVTVEDETYRVVLERGTLDIWVNGDRVDVTGEFVENGTETHFTIGDTPAYIKAVSSCNKKEGLLYSLISKLKTN
ccccccCEEEEEccCEEEEEEEEcccccEEEEEEEEccEEHHHHHccEEEEEEEEEEccEEEEEEEEcccEEEEEccEEEEEEEEEECccCEEEEEEccccEEEEEEEEcccEEEEEEEEHHHcccc
MFRLVGEESFQLDSKVPCLIKIEPSGPFGYAYSITVDGKTLEKFSQSKANCTWIVTVEDETYRVVLERGTLDIWVNGDRVDVTGEFVENGTETHFTIGDTPAYIKAVSSCNKKEGLLYSLISKLK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRLVGEESFQLDSKVPCLIKIEPSGPFGYAYSITVDGKTLEKFSQSKANCTWIVTVEDETYRVVLERGTLDIWVNGDRVDVTGEFVENGTETHFTIGDTPAYIKAVSSCNKKEGLLYSLISKLKTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Fas apoptotic inhibitory molecule 1 Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.confidentQ9NVQ4
Fas apoptotic inhibitory molecule 1 Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.confidentQ9WUD8
Fas apoptotic inhibitory molecule 1 Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.confidentQ0IIF6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KD2, chain A
Confidence level:very confident
Coverage over the Query: 46-126
View the alignment between query and template
View the model in PyMOL
Template: 3MX7, chain A
Confidence level:very confident
Coverage over the Query: 1-45
View the alignment between query and template
View the model in PyMOL