Diaphorina citri psyllid: psy16758


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MDNSPEAQEIIYHEKQMKELCALHALNNLFQNPKTFSKADLDEICINLSPQTWLNPHRSILGLGNYDINVIMTALQKKGFESNWFDRRKDPKCIDQQKVEGYILNIPSQFKIGKYVPTPIKRRHWLTVRNINGIYYNLDSKLDNPEHIGREEDLVEYLRDVLSDIDKELFVVTRIENSKSYFKENS
cccccccccccEEEEHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHcccEEEEEccccccccccccccccEEEccccccccccccccccccccEEEEEEEccEEEEcccccccccccccHHHHHHHHHHHHccccEEEEEEEEECcccccccccc
*********IIYHEKQMKELCALHALNNLFQNPKTFSKADLDEICINLSPQTWLNPHRSILGLGNYDINVIMTALQKKGFESNWFDRRKDPKCIDQQKVEGYILNIPSQFKIGKYVPTPIKRRHWLTVRNINGIYYNLDSKLDNPEHIGREEDLVEYLRDVLSDIDKELFVVTRIEN*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNSPEAQEIIYHEKQMKELCALHALNNLFQNPKTFSKADLDEICINLSPQTWLNPHRSILGLGNYDINVIMTALQKKGFESNWFDRRKDPKCIDQQKVEGYILNIPSQFKIGKYVPTPIKRRHWLTVRNINGIYYNLDSKLDNPEHIGREEDLVEYLRDVLSDIDKELFVVTRIENSKSYFKENS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Josephin-like protein May act as a deubiquitinating enzyme.confidentQ9W422
Josephin-2 Cleaves 'Lys-63'-linked poly-ubiquitin chains, and with lesser efficiency 'Lys-48'-linked poly-ubiquitin chains (in vitro). May act as a deubiquitinating enzyme.confidentQ9CR30
Josephin-1 Has low protease activity towards poly-ubiquitin chains (in vitro). May act as a deubiquitinating enzyme.confidentQ5R739

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016579 [BP]protein deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0004843 [MF]ubiquitin-specific protease activityprobableGO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0008242 [MF]omega peptidase activityprobableGO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0021551 [BP]central nervous system morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O65, chain A
Confidence level:very confident
Coverage over the Query: 9-106,122-179
View the alignment between query and template
View the model in PyMOL