Diaphorina citri psyllid: psy16761


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
HLLLAESWRELFILGLAQYLPSLDLGELVESCKSRHVDIEEEVIRFQSVLNEFKVLNIDPYEYDYIRAITLFKTAFTSRRELAGHLLLAESWRELFILGLAQYLPSLDLGELVESCKSRHVDIEEEVIRFQSVLNEFKVLNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESCLRDVIAIAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNAG
cccHHcccHHHHHHcHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccccHHccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHcHHcccccccHHHHHHHHHHccc
HLLLAESWRELFILGLAQYLPSLDLGELVESCKSRHVDIEEEVIRFQSVLNEFKVLNIDPYEYDYIRAITLFKTAFTSRRELAGHLLLAESWRELFILGLAQYLPSLDLGELVESCKSRHVDIEEEVIRFQSVLNEFKVLNIDPYEYDYIRAITLFKTVIEDE******************SCLRDVIAIAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HLLLAESWRELFILGLAQYLPSLDLGELVESCKSRHVDIEEEVIRFQSVLNEFKVLNIDPYEYDYIRAITLFKTAFTSRRELAGHLLLAESWRELFILGLAQYLPSLDLGELVESCKSRHVDIEEEVIRFQSVLNEFKVLNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESCLRDVIAIAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000981 [MF]sequence-specific DNA binding RNA polymerase II transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P0U, chain A
Confidence level:very confident
Coverage over the Query: 73-159,181-259
View the alignment between query and template
View the model in PyMOL
Template: 3P0U, chain A
Confidence level:very confident
Coverage over the Query: 2-103
View the alignment between query and template
View the model in PyMOL