Psyllid ID: psy16761
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 261 | 2.2.26 [Sep-21-2011] | |||||||
| Q64104 | 385 | Nuclear receptor subfamil | yes | N/A | 0.613 | 0.415 | 0.355 | 4e-22 | |
| Q9Y466 | 385 | Nuclear receptor subfamil | yes | N/A | 0.613 | 0.415 | 0.355 | 5e-22 | |
| Q91379 | 385 | Nuclear receptor subfamil | yes | N/A | 0.613 | 0.415 | 0.355 | 5e-22 | |
| P70052 | 386 | Nuclear receptor subfamil | N/A | N/A | 0.616 | 0.417 | 0.360 | 8e-22 | |
| Q9YGL3 | 396 | Nuclear receptor subfamil | N/A | N/A | 0.613 | 0.404 | 0.338 | 8e-21 | |
| P18102 | 452 | Protein tailless OS=Droso | yes | N/A | 0.628 | 0.362 | 0.357 | 2e-20 | |
| O16845 | 450 | Protein tailless OS=Droso | N/A | N/A | 0.655 | 0.38 | 0.349 | 6e-19 | |
| Q9Y5X4 | 410 | Photoreceptor-specific nu | no | N/A | 0.578 | 0.368 | 0.316 | 5e-15 | |
| Q9TTF0 | 411 | Photoreceptor-specific nu | no | N/A | 0.578 | 0.367 | 0.327 | 1e-14 | |
| Q9TTR7 | 414 | COUP transcription factor | no | N/A | 0.563 | 0.355 | 0.307 | 6e-14 |
| >sp|Q64104|NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus GN=Nr2e1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 105 bits (261), Expect = 4e-22, Method: Compositional matrix adjust.
Identities = 65/183 (35%), Positives = 98/183 (53%), Gaps = 23/183 (12%)
Query: 86 LLLAESWRELFILGLAQYLPSLDLGEL--VESCKSRHVDIEE------EVIRFQSVLNEF 137
+LL ++WRELF+LG+AQ+ +D L V + + D ++ E+ Q V+ F
Sbjct: 216 MLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNTDNTDSQKLNKIISEIQALQEVVARF 275
Query: 138 KVLNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESCLRDVIAIAAIQGHT 197
+ L +D E+ ++ I FK V + RS R+ AIAA+Q
Sbjct: 276 RQLRLDATEFACLKCIVTFKAVPTHSGSELRS--------------FRNAAAIAALQDEA 321
Query: 198 QIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMY 257
Q+ LN YIHT YP+QP RF K+ L+LP L+SI +EE+FF+ IG N I + + MY
Sbjct: 322 QLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIG-NVPITRLLSDMY 380
Query: 258 KNA 260
K++
Sbjct: 381 KSS 383
|
Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity (By similarity). Regulates cell cycle progression in neural stem cells of rhe developing brain. Involved in the regulation of retinal development and essential for vision. During retinogenesis, regulates PTEN-Cyclin D expression via binding to the promoter region of PTEN and suppressing its activity. May be involved in retinoic acid receptor (RAR) regulation in retinal cells. Mus musculus (taxid: 10090) |
| >sp|Q9Y466|NR2E1_HUMAN Nuclear receptor subfamily 2 group E member 1 OS=Homo sapiens GN=NR2E1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q91379|NR2E1_CHICK Nuclear receptor subfamily 2 group E member 1 OS=Gallus gallus GN=NR2E1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P70052|NR2E1_XENLA Nuclear receptor subfamily 2 group E member 1 OS=Xenopus laevis GN=nr2e1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9YGL3|NR2E1_ORYLA Nuclear receptor subfamily 2 group E member 1 OS=Oryzias latipes GN=nr2e1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P18102|TLL_DROME Protein tailless OS=Drosophila melanogaster GN=tll PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O16845|TLL_DROVI Protein tailless OS=Drosophila virilis GN=tll PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y5X4|NR2E3_HUMAN Photoreceptor-specific nuclear receptor OS=Homo sapiens GN=NR2E3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9TTF0|NR2E3_BOVIN Photoreceptor-specific nuclear receptor OS=Bos taurus GN=NR2E3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9TTR7|COT2_BOVIN COUP transcription factor 2 OS=Bos taurus GN=NR2F2 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 261 | ||||||
| 242013777 | 403 | Orphan nuclear receptor NR2E1, putative | 0.651 | 0.421 | 0.430 | 1e-27 | |
| 291232333 | 308 | PREDICTED: tailless-like [Saccoglossus k | 0.605 | 0.512 | 0.365 | 6e-25 | |
| 259013325 | 361 | tailless [Saccoglossus kowalevskii] gi|3 | 0.605 | 0.437 | 0.370 | 7e-25 | |
| 443724903 | 393 | hypothetical protein CAPTEDRAFT_226190 [ | 0.609 | 0.404 | 0.368 | 3e-24 | |
| 321478244 | 337 | tailless-like protein [Daphnia pulex] | 0.647 | 0.501 | 0.341 | 3e-22 | |
| 405978560 | 380 | Nuclear receptor subfamily 2 group E mem | 0.616 | 0.423 | 0.344 | 4e-22 | |
| 270002751 | 406 | tailless [Tribolium castaneum] | 0.685 | 0.440 | 0.376 | 8e-21 | |
| 86515358 | 406 | tailless [Tribolium castaneum] gi|809668 | 0.685 | 0.440 | 0.376 | 9e-21 | |
| 149046956 | 385 | rCG58537 [Rattus norvegicus] | 0.613 | 0.415 | 0.360 | 1e-20 | |
| 354469258 | 518 | PREDICTED: nuclear receptor subfamily 2 | 0.613 | 0.308 | 0.360 | 1e-20 |
| >gi|242013777|ref|XP_002427577.1| Orphan nuclear receptor NR2E1, putative [Pediculus humanus corporis] gi|212511992|gb|EEB14839.1| Orphan nuclear receptor NR2E1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 129 bits (325), Expect = 1e-27, Method: Compositional matrix adjust.
Identities = 77/179 (43%), Positives = 111/179 (62%), Gaps = 9/179 (5%)
Query: 86 LLLAESWRELFILGLAQYLPSLDLGEL------VESCKSRHVDIEEEVIRFQSVLNEFKV 139
LLL ESWRELF+L +Q++ L+L +L V + + + I +EV +FQ L +FK
Sbjct: 225 LLLEESWRELFVLSASQFMLPLELVDLLTAHTTVTANSEKALTIAQEVKQFQETLIKFKQ 284
Query: 140 LNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESCLRDVIAIAAIQGHTQI 199
L++D +EY +RAI LFKT + +N +SS+ S L D+ +AA+Q HTQ+
Sbjct: 285 LHVDIHEYACLRAIVLFKTSFDPS--NNTVTSSTAPSSSGEGKTLHDLAEVAAVQDHTQL 342
Query: 200 FLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYK 258
LNKYI +P+QP RF K+ L+LP L+S+ + +EELFFR IG N I++ I MYK
Sbjct: 343 TLNKYISAAHPTQPFRFGKLLLLLPSLRSVSNNTIEELFFRRTIG-NIPIERIICDMYK 400
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|291232333|ref|XP_002736112.1| PREDICTED: tailless-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|259013325|ref|NP_001158362.1| tailless [Saccoglossus kowalevskii] gi|32307797|gb|AAP79295.1| tailless [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|443724903|gb|ELU12704.1| hypothetical protein CAPTEDRAFT_226190 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|321478244|gb|EFX89201.1| tailless-like protein [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|405978560|gb|EKC42940.1| Nuclear receptor subfamily 2 group E member 1 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|270002751|gb|EEZ99198.1| tailless [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|86515358|ref|NP_001034502.1| tailless [Tribolium castaneum] gi|8096685|gb|AAF71999.1|AF219117_1 tailless ortholog [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|149046956|gb|EDL99704.1| rCG58537 [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
| >gi|354469258|ref|XP_003497047.1| PREDICTED: nuclear receptor subfamily 2 group E member 1-like [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 261 | ||||||
| UNIPROTKB|F1NTE7 | 269 | F1NTE7 "Uncharacterized protei | 0.647 | 0.628 | 0.343 | 2.4e-21 | |
| UNIPROTKB|F1NNE1 | 175 | F1NNE1 "Uncharacterized protei | 0.613 | 0.914 | 0.349 | 4.9e-21 | |
| ZFIN|ZDB-GENE-040801-127 | 396 | nr2e1 "nuclear receptor subfam | 0.613 | 0.404 | 0.349 | 5.3e-21 | |
| MGI|MGI:1100526 | 385 | Nr2e1 "nuclear receptor subfam | 0.613 | 0.415 | 0.349 | 5.6e-21 | |
| UNIPROTKB|Q91379 | 385 | NR2E1 "Nuclear receptor subfam | 0.613 | 0.415 | 0.349 | 7.4e-21 | |
| UNIPROTKB|F1MN68 | 385 | NR2E1 "Uncharacterized protein | 0.613 | 0.415 | 0.349 | 7.4e-21 | |
| UNIPROTKB|F1PD89 | 385 | NR2E1 "Uncharacterized protein | 0.613 | 0.415 | 0.349 | 7.4e-21 | |
| UNIPROTKB|Q9Y466 | 385 | NR2E1 "Nuclear receptor subfam | 0.613 | 0.415 | 0.349 | 7.4e-21 | |
| UNIPROTKB|I3LU21 | 385 | NR2E1 "Uncharacterized protein | 0.613 | 0.415 | 0.349 | 7.4e-21 | |
| UNIPROTKB|F1RT26 | 421 | NR2E1 "Uncharacterized protein | 0.613 | 0.380 | 0.349 | 1.3e-20 |
| UNIPROTKB|F1NTE7 F1NTE7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 250 (93.1 bits), Expect = 2.4e-21, P = 2.4e-21
Identities = 67/195 (34%), Positives = 104/195 (53%)
Query: 74 TAFTSRRELAGHLLLAESWRELFILGLAQYLPSLDLGELV-------ESCKSRHVD-IEE 125
T S+ +L +LL ++WRELF+LG+AQ+ +D L+ ++ S+ ++ I
Sbjct: 91 TCIVSQHQL---MLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIIS 147
Query: 126 EVIRFQSVLNEFKVLNIDPYEYDYIRAITLFKTVIEDEVKDNRXXXXXXXXXEHPESCLR 185
E+ Q V+ F+ L +D E+ ++ I FK V + R R
Sbjct: 148 EIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRS--------------FR 193
Query: 186 DVIAIAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGH 245
+ AIAA+Q Q+ LN YIHT YP+QP RF K+ L+LP L+SI +EE+FF+ IG
Sbjct: 194 NAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIG- 252
Query: 246 NTTIKKTIWHMYKNA 260
N I + + MYK++
Sbjct: 253 NVPITRLLSDMYKSS 267
|
|
| UNIPROTKB|F1NNE1 F1NNE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-127 nr2e1 "nuclear receptor subfamily 2, group E, member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1100526 Nr2e1 "nuclear receptor subfamily 2, group E, member 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q91379 NR2E1 "Nuclear receptor subfamily 2 group E member 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MN68 NR2E1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PD89 NR2E1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y466 NR2E1 "Nuclear receptor subfamily 2 group E member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LU21 NR2E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RT26 NR2E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 261 | |||
| cd06950 | 206 | cd06950, NR_LBD_Tlx_PNR_like, The ligand binding d | 2e-38 | |
| cd06930 | 165 | cd06930, NR_LBD_F2, Ligand-binding domain of nucle | 6e-22 | |
| cd06948 | 236 | cd06948, NR_LBD_COUP-TF, Ligand binding domain of | 4e-20 | |
| cd06950 | 206 | cd06950, NR_LBD_Tlx_PNR_like, The ligand binding d | 1e-17 | |
| cd06951 | 222 | cd06951, NR_LBD_Dax1_like, The ligand binding doma | 5e-15 | |
| cd06952 | 222 | cd06952, NR_LBD_TR2_like, The ligand binding domai | 6e-15 | |
| cd07349 | 222 | cd07349, NR_LBD_SHP, The ligand binding domain of | 2e-12 | |
| cd06930 | 165 | cd06930, NR_LBD_F2, Ligand-binding domain of nucle | 4e-12 | |
| cd07350 | 232 | cd07350, NR_LBD_Dax1, The ligand binding domain of | 2e-07 | |
| cd06931 | 222 | cd06931, NR_LBD_HNF4_like, The ligand binding doma | 1e-06 | |
| pfam00104 | 186 | pfam00104, Hormone_recep, Ligand-binding domain of | 2e-06 | |
| cd06952 | 222 | cd06952, NR_LBD_TR2_like, The ligand binding domai | 3e-06 | |
| smart00430 | 163 | smart00430, HOLI, Ligand binding domain of hormone | 5e-06 | |
| cd06943 | 207 | cd06943, NR_LBD_RXR_like, The ligand binding domai | 1e-05 | |
| cd06157 | 168 | cd06157, NR_LBD, The ligand binding domain of nucl | 1e-04 | |
| cd06953 | 213 | cd06953, NR_LBD_DHR4_like, The ligand binding doma | 2e-04 | |
| cd06948 | 236 | cd06948, NR_LBD_COUP-TF, Ligand binding domain of | 0.001 | |
| cd07349 | 222 | cd07349, NR_LBD_SHP, The ligand binding domain of | 0.001 |
| >gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
Score = 132 bits (335), Expect = 2e-38
Identities = 60/167 (35%), Positives = 82/167 (49%), Gaps = 29/167 (17%)
Query: 85 HLLLAESWRELFILGLAQYLPSLDLGELVESCKS------RHVDIEEEVIRFQSVLNEFK 138
+LL ESW ELF+LG AQ+ LD L+ EV Q L+ F+
Sbjct: 61 LILLEESWSELFLLGAAQWSLPLDSCPLLAVPGLSPDNTEAERTFLSEVRALQETLSRFR 120
Query: 139 VLNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESC-LRDVIAIAAIQGHT 197
L +D E+ ++AI LFK PE+ L+D + A+Q
Sbjct: 121 QLRVDATEFACLKAIVLFK----------------------PETRGLKDPAQVEALQDQA 158
Query: 198 QIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIG 244
Q+ LNK+I T YP+QP RF K+ L+LP L+ I S +EELFF+ IG
Sbjct: 159 QLMLNKHIRTRYPTQPARFGKLLLLLPSLRFISSSTIEELFFKKTIG 205
|
The ligand binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like family: This family includes photoreceptor cell-specific nuclear receptor (PNR), Tailless (TLX), and related receptors. TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX and PNR have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 206 |
| >gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132749 cd06951, NR_LBD_Dax1_like, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >gnl|CDD|132763 cd07349, NR_LBD_SHP, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132764 cd07350, NR_LBD_Dax1, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >gnl|CDD|215719 pfam00104, Hormone_recep, Ligand-binding domain of nuclear hormone receptor | Back alignment and domain information |
|---|
| >gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132726 cd06157, NR_LBD, The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >gnl|CDD|132751 cd06953, NR_LBD_DHR4_like, The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|132763 cd07349, NR_LBD_SHP, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 261 | |||
| cd07349 | 222 | NR_LBD_SHP The ligand binding domain of DAX1 prote | 100.0 | |
| cd06937 | 231 | NR_LBD_RAR The ligand binding domain (LBD) of reti | 100.0 | |
| cd07070 | 237 | NR_LBD_SF-1 The ligand binding domain of nuclear r | 100.0 | |
| cd07348 | 238 | NR_LBD_NGFI-B The ligand binding domain of Nurr1, | 100.0 | |
| cd06948 | 236 | NR_LBD_COUP-TF Ligand binding domain of chicken ov | 100.0 | |
| cd07069 | 241 | NR_LBD_Lrh-1 The ligand binding domain of the live | 100.0 | |
| cd06944 | 237 | NR_LBD_Ftz-F1_like The ligand binding domain of FT | 100.0 | |
| cd06951 | 222 | NR_LBD_Dax1_like The ligand binding domain of DAX1 | 100.0 | |
| cd06949 | 235 | NR_LBD_ER Ligand binding domain of Estrogen recept | 100.0 | |
| cd07350 | 232 | NR_LBD_Dax1 The ligand binding domain of DAX1 prot | 100.0 | |
| cd06945 | 239 | NR_LBD_Nurr1_like The ligand binding domain of Nur | 100.0 | |
| cd07071 | 238 | NR_LBD_Nurr1 The ligand binding domain of Nurr1, a | 100.0 | |
| cd07072 | 239 | NR_LBD_DHR38_like Ligand binding domain of DHR38_l | 99.98 | |
| cd07076 | 247 | NR_LBD_GR Ligand binding domain of the glucocortic | 99.98 | |
| cd06935 | 243 | NR_LBD_TR The ligand binding domain of thyroid hor | 99.97 | |
| cd06946 | 221 | NR_LBD_ERR The ligand binding domain of estrogen r | 99.97 | |
| cd06950 | 206 | NR_LBD_Tlx_PNR_like The ligand binding domain of T | 99.97 | |
| cd07073 | 246 | NR_LBD_AR Ligand binding domain of the nuclear rec | 99.97 | |
| cd07068 | 221 | NR_LBD_ER_like The ligand binding domain of estrog | 99.97 | |
| cd06947 | 246 | NR_LBD_GR_Like Ligand binding domain of nuclear ho | 99.97 | |
| cd06941 | 195 | NR_LBD_DmE78_like The ligand binding domain of Dro | 99.97 | |
| cd06932 | 259 | NR_LBD_PPAR The ligand binding domain of peroxisom | 99.96 | |
| cd06952 | 222 | NR_LBD_TR2_like The ligand binding domain of the o | 99.96 | |
| cd06939 | 241 | NR_LBD_ROR_like The ligand binding domain of Retin | 99.96 | |
| cd06954 | 236 | NR_LBD_LXR The ligand binding domain of Liver X re | 99.96 | |
| cd07075 | 248 | NR_LBD_MR Ligand binding domain of the mineralocor | 99.96 | |
| cd06940 | 189 | NR_LBD_REV_ERB The ligand binding domain of REV-ER | 99.96 | |
| cd06933 | 238 | NR_LBD_VDR The ligand binding domain of vitamin D | 99.95 | |
| cd06936 | 221 | NR_LBD_Fxr The ligand binding domain of Farnesoid | 99.95 | |
| cd06934 | 226 | NR_LBD_PXR_like The ligand binding domain of xenob | 99.94 | |
| cd06943 | 207 | NR_LBD_RXR_like The ligand binding domain of the r | 99.94 | |
| cd06938 | 231 | NR_LBD_EcR The ligand binding domain (LBD) of the | 99.94 | |
| cd06931 | 222 | NR_LBD_HNF4_like The ligand binding domain of hept | 99.94 | |
| cd06953 | 213 | NR_LBD_DHR4_like The ligand binding domain of orph | 99.94 | |
| KOG4215|consensus | 432 | 99.94 | ||
| cd06929 | 174 | NR_LBD_F1 Ligand-binding domain of nuclear recepto | 99.92 | |
| cd06930 | 165 | NR_LBD_F2 Ligand-binding domain of nuclear recepto | 99.91 | |
| cd07074 | 248 | NR_LBD_PR Ligand binding domain of the progesteron | 99.91 | |
| cd06942 | 191 | NR_LBD_Sex_1_like The ligand binding domain of Cae | 99.9 | |
| cd06157 | 168 | NR_LBD The ligand binding domain of nuclear recept | 99.79 | |
| smart00430 | 163 | HOLI Ligand binding domain of hormone receptors. | 99.79 | |
| PF00104 | 203 | Hormone_recep: Ligand-binding domain of nuclear ho | 99.77 | |
| KOG4217|consensus | 605 | 99.74 | ||
| KOG4218|consensus | 475 | 99.67 | ||
| cd07350 | 232 | NR_LBD_Dax1 The ligand binding domain of DAX1 prot | 99.65 | |
| cd07076 | 247 | NR_LBD_GR Ligand binding domain of the glucocortic | 99.64 | |
| cd07349 | 222 | NR_LBD_SHP The ligand binding domain of DAX1 prote | 99.64 | |
| cd07075 | 248 | NR_LBD_MR Ligand binding domain of the mineralocor | 99.64 | |
| cd06937 | 231 | NR_LBD_RAR The ligand binding domain (LBD) of reti | 99.63 | |
| cd07348 | 238 | NR_LBD_NGFI-B The ligand binding domain of Nurr1, | 99.63 | |
| cd06947 | 246 | NR_LBD_GR_Like Ligand binding domain of nuclear ho | 99.63 | |
| cd07069 | 241 | NR_LBD_Lrh-1 The ligand binding domain of the live | 99.62 | |
| cd07071 | 238 | NR_LBD_Nurr1 The ligand binding domain of Nurr1, a | 99.6 | |
| cd07072 | 239 | NR_LBD_DHR38_like Ligand binding domain of DHR38_l | 99.6 | |
| cd07073 | 246 | NR_LBD_AR Ligand binding domain of the nuclear rec | 99.6 | |
| cd06940 | 189 | NR_LBD_REV_ERB The ligand binding domain of REV-ER | 99.59 | |
| cd06935 | 243 | NR_LBD_TR The ligand binding domain of thyroid hor | 99.58 | |
| cd06951 | 222 | NR_LBD_Dax1_like The ligand binding domain of DAX1 | 99.58 | |
| cd06950 | 206 | NR_LBD_Tlx_PNR_like The ligand binding domain of T | 99.58 | |
| cd07070 | 237 | NR_LBD_SF-1 The ligand binding domain of nuclear r | 99.56 | |
| cd06949 | 235 | NR_LBD_ER Ligand binding domain of Estrogen recept | 99.56 | |
| cd06945 | 239 | NR_LBD_Nurr1_like The ligand binding domain of Nur | 99.56 | |
| cd07074 | 248 | NR_LBD_PR Ligand binding domain of the progesteron | 99.54 | |
| cd06944 | 237 | NR_LBD_Ftz-F1_like The ligand binding domain of FT | 99.52 | |
| cd06939 | 241 | NR_LBD_ROR_like The ligand binding domain of Retin | 99.51 | |
| cd06933 | 238 | NR_LBD_VDR The ligand binding domain of vitamin D | 99.5 | |
| cd06941 | 195 | NR_LBD_DmE78_like The ligand binding domain of Dro | 99.49 | |
| cd06948 | 236 | NR_LBD_COUP-TF Ligand binding domain of chicken ov | 99.49 | |
| cd06954 | 236 | NR_LBD_LXR The ligand binding domain of Liver X re | 99.47 | |
| cd06934 | 226 | NR_LBD_PXR_like The ligand binding domain of xenob | 99.46 | |
| cd06953 | 213 | NR_LBD_DHR4_like The ligand binding domain of orph | 99.45 | |
| cd06943 | 207 | NR_LBD_RXR_like The ligand binding domain of the r | 99.44 | |
| cd06946 | 221 | NR_LBD_ERR The ligand binding domain of estrogen r | 99.41 | |
| KOG4216|consensus | 479 | 99.4 | ||
| cd06932 | 259 | NR_LBD_PPAR The ligand binding domain of peroxisom | 99.39 | |
| cd06952 | 222 | NR_LBD_TR2_like The ligand binding domain of the o | 99.38 | |
| cd06936 | 221 | NR_LBD_Fxr The ligand binding domain of Farnesoid | 99.37 | |
| cd06929 | 174 | NR_LBD_F1 Ligand-binding domain of nuclear recepto | 99.36 | |
| cd07068 | 221 | NR_LBD_ER_like The ligand binding domain of estrog | 99.34 | |
| cd06938 | 231 | NR_LBD_EcR The ligand binding domain (LBD) of the | 99.32 | |
| cd06930 | 165 | NR_LBD_F2 Ligand-binding domain of nuclear recepto | 99.3 | |
| cd06942 | 191 | NR_LBD_Sex_1_like The ligand binding domain of Cae | 99.29 | |
| KOG4215|consensus | 432 | 99.26 | ||
| cd06931 | 222 | NR_LBD_HNF4_like The ligand binding domain of hept | 99.13 | |
| KOG4218|consensus | 475 | 99.0 | ||
| smart00430 | 163 | HOLI Ligand binding domain of hormone receptors. | 98.77 | |
| cd06157 | 168 | NR_LBD The ligand binding domain of nuclear recept | 98.74 | |
| PF00104 | 203 | Hormone_recep: Ligand-binding domain of nuclear ho | 98.59 | |
| KOG4217|consensus | 605 | 98.5 | ||
| KOG4216|consensus | 479 | 96.88 |
| >cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.6e-34 Score=243.52 Aligned_cols=163 Identities=31% Similarity=0.474 Sum_probs=145.9
Q ss_pred ccccccccchhHHHHHHHHHHHHHHHHHhhhcCCCCCcc---------ccccccc---------cchhHHHHHHHHHHHH
Q psy16761 73 KTAFTSRRELAGHLLLAESWRELFILGLAQYLPSLDLGE---------LVESCKS---------RHVDIEEEVIRFQSVL 134 (261)
Q Consensus 73 ~p~f~~L~~~dqv~lLq~~~~e~l~L~~a~~s~~~~~~~---------ll~~~~~---------~~~~~~~~~~~l~~~~ 134 (261)
.|+|.+|+.+||+.+||.+|.|++++++||++.+++... ++..+.. ........++.+++++
T Consensus 42 iP~F~~L~~~DQi~LLk~~W~EL~iL~laq~s~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~e~~ 121 (222)
T cd07349 42 LPSFWQLPPQDQLLLLQNCWGPLFLLGLAQDRVTFEVAEAPVPSMLKKILLEGQSSSGGSGQPDRPQPSLAAVQWLQCCL 121 (222)
T ss_pred CCCcccCChHHHHHHHHHccHHHHHHHHHHHccccccccccchhHHHHHHhcccccccccchhhhhhhHHHHHHHHHHHH
Confidence 599999999999999999999999999999998876432 2222110 0122344567788999
Q ss_pred HHHHhcCCChhhhhhhhHhhhcccCcccccccCCCCCCCCCCCCCCCcCcCcHHHHHHHHHHHHHHHHHHHHhcCCCCcc
Q psy16761 135 NEFKVLNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESCLRDVIAIAAIQGHTQIFLNKYIHTVYPSQPT 214 (261)
Q Consensus 135 ~~l~~L~l~~~E~~lLkai~l~~pd~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~i~~lq~~~~~~L~~~~~~~~~~~~~ 214 (261)
.+|++|++|.+||+|||||+||||| ++|+++..+|+.+|++++.+|++|+..+||++|.
T Consensus 122 ~~l~~L~ld~~Eya~LkaivLf~pd---------------------~~gl~~~~~V~~lqe~~~~aL~~~~~~~~p~~~~ 180 (222)
T cd07349 122 NKFWSLDLSPKEYAYLKGTILFNPD---------------------VPGLTASSHVGHLQQEAQWALCEVLEPLHPQDQG 180 (222)
T ss_pred HHHHHcCCCHHHHHHHHHHHHcCCC---------------------cccCCCHHHHHHHHHHHHHHHHHHHHHHCCCccc
Confidence 9999999999999999999999999 9999999999999999999999999999999999
Q ss_pred HHHHHHhhcccccCCCcccchhhhcccccCCCCcHHHHHHHHH
Q psy16761 215 RFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMY 257 (261)
Q Consensus 215 Rf~~LL~~Lp~Lr~~~~~~~e~l~f~~~~g~~~~i~~ll~eml 257 (261)
||+|||++||.||+++.+.+|++||++++| ++||++++.||+
T Consensus 181 r~~kLLl~Lp~LR~i~~~~ie~lff~~~~g-~~~i~~Ll~eml 222 (222)
T cd07349 181 RFARILLTASTLKSIPPSLITDLFFRPIIG-DADIAELLGDML 222 (222)
T ss_pred HHHHHHHHhHHHhcCCHHHHHHHhCccccC-CCcHHHHHHHhC
Confidence 999999999999999999999999999999 999999999996
|
The ligand binding domain of the Small Heterodimer Partner (SHP): SHP is a member of the nuclear receptor superfamily. SHP has a ligand binding domain, but lacks the DNA binding domain, typical to almost all of the nuclear receptors. It functions as a transcriptional coregulator by directly interacting with other nuclear receptors through its AF-2 motif. The closest relative of SHP is DAX1 and they can form heterodimer. SHP is an orphan receptor, lacking an identified ligand. |
| >cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors | Back alignment and domain information |
|---|
| >cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors | Back alignment and domain information |
|---|
| >cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor | Back alignment and domain information |
|---|
| >cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
| >cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >KOG4215|consensus | Back alignment and domain information |
|---|
| >cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein | Back alignment and domain information |
|---|
| >cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >smart00430 HOLI Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
| >cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors | Back alignment and domain information |
|---|
| >cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor | Back alignment and domain information |
|---|
| >cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors | Back alignment and domain information |
|---|
| >cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
| >cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein | Back alignment and domain information |
|---|
| >KOG4215|consensus | Back alignment and domain information |
|---|
| >cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
| >smart00430 HOLI Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 261 | ||||
| 3cjw_A | 244 | Crystal Structure Of The Human Coup-Tfii Ligand Bin | 4e-15 | ||
| 3p0u_A | 249 | Crystal Structure Of The Ligand Binding Domain Of H | 1e-11 | ||
| 1z5x_U | 262 | Hemipteran Ecdysone Receptor Ligand-Binding Domain | 8e-07 | ||
| 2q60_A | 258 | Crystal Structure Of The Ligand Binding Domain Of P | 4e-06 | ||
| 2nxx_A | 235 | Crystal Structure Of The Ligand-Binding Domains Of | 7e-06 | ||
| 3eyb_A | 219 | Structural And Functional Insights Into The Ligand | 2e-05 | ||
| 1lbd_A | 282 | Ligand-Binding Domain Of The Human Nuclear Receptor | 2e-05 | ||
| 1rdt_A | 242 | Crystal Structure Of A New Rexinoid Bound To The Rx | 2e-05 | ||
| 3uvv_B | 244 | Crystal Structure Of The Ligand Binding Domains Of | 2e-05 | ||
| 1xdk_A | 238 | Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN | 2e-05 | ||
| 1fm6_A | 238 | The 2.1 Angstrom Resolution Crystal Structure Of Th | 2e-05 | ||
| 1fby_A | 239 | Crystal Structure Of The Human Rxr Alpha Ligand Bin | 2e-05 | ||
| 3e94_A | 244 | Crystal Structure Of Rxralpha Ligand Binding Domain | 2e-05 | ||
| 1mv9_A | 240 | Crystal Structure Of The Human Rxr Alpha Ligand Bin | 2e-05 | ||
| 1xv9_A | 236 | Crystal Structure Of CarRXR HETERODIMER BOUND WITH | 2e-05 | ||
| 3oap_A | 231 | Crystal Structure Of Human Retinoid X Receptor Alph | 2e-05 | ||
| 1xls_A | 232 | Crystal Structure Of The Mouse CarRXR LBD HETERODIM | 2e-05 | ||
| 3pcu_A | 230 | Crystal Structure Of Human Retinoic X Receptor Alph | 2e-05 | ||
| 3h0a_A | 228 | Crystal Structure Of Peroxisome Proliferator-Activa | 2e-05 | ||
| 3a9e_A | 240 | Crystal Structure Of A Mixed Agonist-Bound Rar-Alph | 3e-05 | ||
| 1dkf_A | 233 | Crystal Structure Of A Heterodimeric Complex Of Rar | 3e-05 | ||
| 2gl8_A | 241 | Human Retinoic Acid Receptor Rxr-Gamma Ligand-Bindi | 4e-05 | ||
| 1xiu_A | 230 | Crystal Structure Of The Agonist-Bound Ligand-Bindi | 7e-05 | ||
| 3dzu_A | 467 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 7e-05 |
| >pdb|3CJW|A Chain A, Crystal Structure Of The Human Coup-Tfii Ligand Binding Domain Length = 244 | Back alignment and structure |
|
| >pdb|3P0U|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Human Testicular Receptor 4 Length = 249 | Back alignment and structure |
| >pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 262 | Back alignment and structure |
| >pdb|2Q60|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Polyandrocarpa Misakiensis Rxr In Tetramer In Absence Of Ligand Length = 258 | Back alignment and structure |
| >pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 | Back alignment and structure |
| >pdb|3EYB|A Chain A, Structural And Functional Insights Into The Ligand Binding Domain Of A Non-Duplicated Rxr From The Invertebrate Chordate Amphioxus Length = 219 | Back alignment and structure |
| >pdb|1LBD|A Chain A, Ligand-Binding Domain Of The Human Nuclear Receptor Rxr-Alpha Length = 282 | Back alignment and structure |
| >pdb|1RDT|A Chain A, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 242 | Back alignment and structure |
| >pdb|3UVV|B Chain B, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 244 | Back alignment and structure |
| >pdb|1XDK|A Chain A, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 238 | Back alignment and structure |
| >pdb|1FM6|A Chain A, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 238 | Back alignment and structure |
| >pdb|1FBY|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To 9-Cis Retinoic Acid Length = 239 | Back alignment and structure |
| >pdb|3E94|A Chain A, Crystal Structure Of Rxralpha Ligand Binding Domain In Complex With Tributyltin And A Coactivator Fragment Length = 244 | Back alignment and structure |
| >pdb|1MV9|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To The Eicosanoid Dha (Docosa Hexaenoic Acid) And A Coactivator Peptide Length = 240 | Back alignment and structure |
| >pdb|1XV9|A Chain A, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 236 | Back alignment and structure |
| >pdb|3OAP|A Chain A, Crystal Structure Of Human Retinoid X Receptor Alpha-Ligand Binding Domain Complex With 9-Cis Retinoic Acid And The Coactivator Peptide Grip-1 Length = 231 | Back alignment and structure |
| >pdb|1XLS|A Chain A, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 232 | Back alignment and structure |
| >pdb|3PCU|A Chain A, Crystal Structure Of Human Retinoic X Receptor Alpha Ligand-Binding Domain Complexed With Lx0278 And Src1 Peptide Length = 230 | Back alignment and structure |
| >pdb|3H0A|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Gamma (Pparg) And Retinoic Acid Receptor Alpha (Rxra) In Complex With 9-Cis Retinoic Acid, Co-Activator Peptide, And A Partial Agonist Length = 228 | Back alignment and structure |
| >pdb|3A9E|A Chain A, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 240 | Back alignment and structure |
| >pdb|1DKF|A Chain A, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 233 | Back alignment and structure |
| >pdb|2GL8|A Chain A, Human Retinoic Acid Receptor Rxr-Gamma Ligand-Binding Domain Length = 241 | Back alignment and structure |
| >pdb|1XIU|A Chain A, Crystal Structure Of The Agonist-Bound Ligand-Binding Domain Of Biomphalaria Glabrata Rxr Length = 230 | Back alignment and structure |
| >pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
Score = 96.9 bits (241), Expect = 2e-24
Identities = 51/188 (27%), Positives = 76/188 (40%), Gaps = 36/188 (19%)
Query: 86 LLLAESWRELFILGLAQYLPSLDLGELVESCKSRHVD--------------IEEEVIRFQ 131
L+ W ELF LGLAQ + L ++ + + + + E + + Q
Sbjct: 70 SLVRACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQ 129
Query: 132 SVLNEFKVLNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESCLRDVIAIA 191
N L+ID YEY Y++AI LF +HP L I
Sbjct: 130 EFCNSMAKLDIDGYEYAYLKAIVLFS-------------------PDHP--GLTSTSQIE 168
Query: 192 AIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKK 251
Q Q+ L Y+ Y R +I + LP L+ + S + EELFF +IG N +I
Sbjct: 169 KFQEAAQMELQDYVQATYSEDTYRLARILVRLPALRLMSSNITEELFFTGLIG-NVSIDS 227
Query: 252 TIWHMYKN 259
I ++ K
Sbjct: 228 IIPYILKM 235
|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 | Back alignment and structure |
|---|
| >1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Length = 243 | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 | Back alignment and structure |
|---|
| >2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 248 | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Length = 270 | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Length = 244 | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} PDB: 3b0w_A* 3kyt_A* 3l0j_A* Length = 248 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 261 | |||
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 100.0 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 100.0 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 100.0 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 99.98 | |
| 3v3e_B | 257 | Nuclear receptor subfamily 4 group A member 1; orp | 99.98 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 99.97 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 99.97 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 99.97 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 99.97 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 99.97 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 99.97 | |
| 3vi8_A | 273 | Peroxisome proliferator-activated receptor alpha; | 99.97 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 99.97 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 99.97 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 99.97 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 99.97 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 99.97 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 99.97 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 99.97 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 99.97 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 99.97 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 99.97 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 99.97 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 99.97 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 99.96 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 99.96 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 99.96 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 99.96 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 99.96 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 99.96 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 99.96 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 99.96 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 99.96 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 99.96 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 99.96 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 99.96 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 99.96 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 99.96 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 99.96 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 99.96 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 99.96 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 99.95 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 99.95 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 99.95 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 99.95 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 99.95 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 99.95 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 99.95 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 99.95 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 99.95 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 99.95 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 99.95 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 99.95 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 99.92 | |
| 3v3e_B | 257 | Nuclear receptor subfamily 4 group A member 1; orp | 99.55 | |
| 3vi8_A | 273 | Peroxisome proliferator-activated receptor alpha; | 99.52 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 99.51 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 99.5 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 99.5 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 99.5 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 99.49 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 99.48 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 99.48 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 99.47 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 99.46 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 99.45 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 99.45 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 99.45 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 99.44 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 99.44 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 99.44 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 99.43 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 99.43 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 99.43 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 99.43 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 99.43 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 99.42 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 99.42 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 99.42 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 99.42 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 99.42 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 99.41 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 99.4 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 99.4 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 99.4 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 99.4 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 99.39 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 99.39 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 99.39 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 99.38 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 99.38 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 99.38 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 99.38 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 99.37 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 99.37 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 99.37 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 99.36 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 99.35 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 99.35 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 99.35 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 99.34 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 99.33 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 99.32 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 99.32 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 99.27 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 99.23 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 99.21 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 99.2 |
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-33 Score=243.93 Aligned_cols=166 Identities=14% Similarity=0.059 Sum_probs=154.6
Q ss_pred ccccccccchhHHHHHHHHHHHHHHHHHhhhcCCCCCccccccccccc-------hhHHHHHHHHHHHHHHHHhcCCChh
Q psy16761 73 KTAFTSRRELAGHLLLAESWRELFILGLAQYLPSLDLGELVESCKSRH-------VDIEEEVIRFQSVLNEFKVLNIDPY 145 (261)
Q Consensus 73 ~p~f~~L~~~dqv~lLq~~~~e~l~L~~a~~s~~~~~~~ll~~~~~~~-------~~~~~~~~~l~~~~~~l~~L~l~~~ 145 (261)
.|+|..|+.+||+.++|++|.++++++.|+++++.+.+.+++++|... .++.+.++.+.+++.+|++|++|.+
T Consensus 59 ip~F~~L~~~DQ~~LLk~~~~el~~L~~a~~s~~~~~~~l~~~~g~~~~~~~~~~~~~~~~~~~i~~~~~~l~~L~ld~~ 138 (243)
T 3ltx_A 59 VPGYTDLSLSDQVHLIECCWMELLLLNCAFRSIEHGGKSLAFAPDLVLDRSSWSTVEMTEIFEQVAAVSEQMMQNHLHKD 138 (243)
T ss_dssp STTGGGSCHHHHHHHHHHHHHHHHHHHHHHHTTTTTTSEEEEETTEEEEHHHHHHTTCHHHHHHHHHHHHHHHHTTCCHH
T ss_pred CcchhcCCHHHHHHHHHHHHHHHHHHHHHHHhccCCCCeEEecCCcccchhhhcccCHHHHHHHHHHHHHHHHHhCCCHH
Confidence 599999999999999999999999999999999887777777777543 2445667788899999999999999
Q ss_pred hhhhhhHhhhcccCcccccccCCCCCCCCCCCCCCCcCcCcHHHHHHHHHHHHHHHHHHHHhcCCCCccHHHHHHhhccc
Q psy16761 146 EYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESCLRDVIAIAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPR 225 (261)
Q Consensus 146 E~~lLkai~l~~pd~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~i~~lq~~~~~~L~~~~~~~~~~~~~Rf~~LL~~Lp~ 225 (261)
||+|||||+||||| ++|+++..+|+++|++++.+|.+||..+||++|.||++||++||.
T Consensus 139 E~~lLkaivL~~pd---------------------~~gL~~~~~v~~lq~~~~~aL~~y~~~~~p~~~~Rf~~LL~~Lp~ 197 (243)
T 3ltx_A 139 ELLLLQAMVLVNAE---------------------VRRLASYNQIFNMQQSLLDAIVDTAQKYHPDNVRHVPAVLLLLTH 197 (243)
T ss_dssp HHHHHHHHHHHTSC---------------------CSCCTTHHHHHHHHHHHHHHHHHHHHHHSTTCSSHHHHHHHHHHH
T ss_pred HHHHHHHHHHhCCC---------------------CCCCCCHHHHHHHHHHHHHHHHHHHHHhCCChhhHHHHHHHHHHH
Confidence 99999999999999 999999999999999999999999999999999999999999999
Q ss_pred ccCCCcccchhhhcccccCCCCcHHHHHHHHHhcC
Q psy16761 226 LKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNA 260 (261)
Q Consensus 226 Lr~~~~~~~e~l~f~~~~g~~~~i~~ll~eml~~~ 260 (261)
||+++.++++.+++.+++| ++|+++++.||+++.
T Consensus 198 Lr~l~~~~~e~l~~~~~~g-~~~~~~Ll~Eml~~~ 231 (243)
T 3ltx_A 198 IRQAGERGIAFFQRLKSEG-VVTFCDLLKEMLDAQ 231 (243)
T ss_dssp HHHHHHHHHHHHHHHHHHC-SSCCCHHHHHHHHHC
T ss_pred HHHHHHHHHHHHHHHHhcC-CCChhHHHHHHHhCc
Confidence 9999999999999999999 999999999999863
|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* | Back alignment and structure |
|---|
| >3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* | Back alignment and structure |
|---|
| >3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* | Back alignment and structure |
|---|
| >3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A | Back alignment and structure |
|---|
| >3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 261 | ||||
| d1g2na_ | 256 | a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth | 3e-16 | |
| d2fvja1 | 271 | a.123.1.1 (A:207-477) Peroxisome proliferator acti | 3e-16 | |
| d2fvja1 | 271 | a.123.1.1 (A:207-477) Peroxisome proliferator acti | 1e-04 | |
| d1pk5a_ | 242 | a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- | 6e-16 | |
| d1pk5a_ | 242 | a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- | 0.001 | |
| d1pzla_ | 233 | a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { | 3e-15 | |
| d1pzla_ | 233 | a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { | 6e-04 | |
| d2e2ra1 | 223 | a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 | 4e-15 | |
| d2e2ra1 | 223 | a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 | 0.002 | |
| d2p54a1 | 267 | a.123.1.1 (A:202-468) Peroxisome proliferator acti | 5e-15 | |
| d2p54a1 | 267 | a.123.1.1 (A:202-468) Peroxisome proliferator acti | 8e-04 | |
| d1xpca_ | 245 | a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom | 7e-15 | |
| d1xpca_ | 245 | a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom | 0.002 | |
| d2b50b1 | 265 | a.123.1.1 (B:211-475) Peroxisome proliferator-acti | 2e-14 | |
| d2b50b1 | 265 | a.123.1.1 (B:211-475) Peroxisome proliferator-acti | 3e-04 | |
| d3d24a1 | 227 | a.123.1.1 (A:194-420) Steroid hormone receptor ERR | 6e-14 | |
| d3d24a1 | 227 | a.123.1.1 (A:194-420) Steroid hormone receptor ERR | 8e-05 | |
| d1fcya_ | 236 | a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g | 7e-14 | |
| d1osha_ | 231 | a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo | 1e-13 | |
| d1osha_ | 231 | a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo | 0.002 | |
| d1hg4a_ | 265 | a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph | 2e-13 | |
| d1ovla_ | 236 | a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma | 2e-13 | |
| d1ovla_ | 236 | a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma | 0.002 | |
| d1pdua_ | 230 | a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui | 6e-13 | |
| d1pdua_ | 230 | a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui | 0.004 | |
| d2p1ta1 | 230 | a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R | 6e-13 | |
| d2j7ya1 | 236 | a.123.1.1 (A:217-452) Estrogen receptor beta {Rat | 1e-12 | |
| d1nhza_ | 247 | a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom | 3e-12 | |
| d1nhza_ | 247 | a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom | 3e-05 | |
| d1n46a_ | 251 | a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b | 1e-11 | |
| d1n83a_ | 251 | a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { | 1e-11 | |
| d1n83a_ | 251 | a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { | 0.002 | |
| d1pq9a_ | 239 | a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human | 2e-11 | |
| d1sqna_ | 251 | a.123.1.1 (A:) Progesterone receptor {Human (Homo | 2e-11 | |
| d1sqna_ | 251 | a.123.1.1 (A:) Progesterone receptor {Human (Homo | 0.002 | |
| d2qw4a1 | 233 | a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 | 3e-11 | |
| d1nq7a_ | 244 | a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R | 4e-11 | |
| d1nq7a_ | 244 | a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R | 0.003 | |
| d1t7ra_ | 250 | a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan | 7e-11 | |
| d1nrla_ | 292 | a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho | 8e-11 | |
| d1nrla_ | 292 | a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho | 0.001 | |
| d2r40d1 | 243 | a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m | 7e-10 | |
| d1xvpb_ | 246 | a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) | 3e-09 | |
| d1xnxa_ | 232 | a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) | 1e-08 | |
| d1ie9a_ | 255 | a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( | 2e-08 |
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Nuclear receptor ligand-binding domain superfamily: Nuclear receptor ligand-binding domain family: Nuclear receptor ligand-binding domain domain: Ultraspiracle protein, usp species: Heliothis virescens [TaxId: 7102]
Score = 74.0 bits (181), Expect = 3e-16
Identities = 36/200 (18%), Positives = 65/200 (32%), Gaps = 47/200 (23%)
Query: 85 HLLLAESWRELFILGLAQYLPSLDLGELVESCKS------------------------RH 120
LL+ SW EL + +A E +
Sbjct: 77 ILLIKGSWNELLLFAIAWRSMEFLTEERDGVDGTGNRTTSPPQLMCLMPGMTLHRNSALQ 136
Query: 121 VDIEEEVIR-FQSVLNEFKVLNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEH 179
+ + R + + + L +D EY ++AI L
Sbjct: 137 AGVGQIFDRVLSELSLKMRTLRVDQAEYVALKAIILLN---------------------P 175
Query: 180 PESCLRDVIAIAAIQGHTQIFLNKYIHTVYPSQPTRFCKIQLILPRLKSIPSLVLEELFF 239
L++ + ++ + L++Y S+ RF + L LP L+SI E LFF
Sbjct: 176 DVKGLKNRQEVEVLREKMFLCLDEYCRRSRSSEEGRFAALLLRLPALRSISLKSFEHLFF 235
Query: 240 RNIIGHNTTIKKTIWHMYKN 259
+++ +T+I I +N
Sbjct: 236 FHLVA-DTSIAGYIRDALRN 254
|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Length = 232 | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 261 | |||
| d1g2na_ | 256 | Ultraspiracle protein, usp {Heliothis virescens [T | 100.0 | |
| d1pk5a_ | 242 | Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus | 100.0 | |
| d1hg4a_ | 265 | Ultraspiracle protein, usp {Drosophila melanogaste | 99.98 | |
| d2e2ra1 | 223 | Orphan nuclear receptor ERR3 {Human (Homo sapiens) | 99.98 | |
| d1pzla_ | 233 | Hepatocyte nuclear factor 4-alpha {Human (Homo sap | 99.97 | |
| d3d24a1 | 227 | Steroid hormone receptor ERR1 {Human (Homo sapiens | 99.97 | |
| d1fcya_ | 236 | Retinoic acid receptor gamma (RAR-gamma) {Human (H | 99.97 | |
| d1ovla_ | 236 | Orphan nuclear receptor NURR1 {Human (Homo sapiens | 99.97 | |
| d2qw4a1 | 233 | Orphan nuclear receptor NR4A1 {Human (Homo sapiens | 99.97 | |
| d1pdua_ | 230 | Nuclear hormone receptor HR38 {Fruit fly (Drosophi | 99.97 | |
| d2p1ta1 | 230 | Retinoid-X receptor alpha (RXR-alpha) {Human (Homo | 99.96 | |
| d1n46a_ | 251 | Thyroid hormone receptor beta (TR-beta) {Human (Ho | 99.96 | |
| d1xpca_ | 245 | Estrogen receptor alpha {Human (Homo sapiens) [Tax | 99.96 | |
| d1pq9a_ | 239 | Oxysterols receptor LXR-beta {Human (Homo sapiens) | 99.96 | |
| d2p54a1 | 267 | Peroxisome proliferator activated receptor alpha, | 99.96 | |
| d2j7ya1 | 236 | Estrogen receptor beta {Rat (Rattus norvegicus) [T | 99.96 | |
| d2fvja1 | 271 | Peroxisome proliferator activated receptor gamma, | 99.96 | |
| d2b50b1 | 265 | Peroxisome proliferator-activated receptor delta, | 99.96 | |
| d1xvpb_ | 246 | Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s | 99.96 | |
| d1osha_ | 231 | Bile acid receptor FXR {Human (Homo sapiens) [TaxI | 99.96 | |
| d1ie9a_ | 255 | Vitamin D nuclear receptor {Human (Homo sapiens) [ | 99.95 | |
| d2r40d1 | 243 | Ecdysone receptor {Noctuid moth (Heliothis viresce | 99.95 | |
| d1nq7a_ | 244 | Orphan nuclear receptor ROR-beta {Rat (Rattus norv | 99.94 | |
| d1t7ra_ | 250 | Androgen receptor {Chimpanzee (Pan troglodytes) [T | 99.94 | |
| d1n83a_ | 251 | Orphan nuclear receptor ROR-alpha {Human (Homo sap | 99.94 | |
| d1nhza_ | 247 | Glucocorticoid receptor {Human (Homo sapiens) [Tax | 99.94 | |
| d1sqna_ | 251 | Progesterone receptor {Human (Homo sapiens) [TaxId | 99.94 | |
| d1nrla_ | 292 | Pregnane x receptor, PXR {Human (Homo sapiens) [Ta | 99.94 | |
| d1xnxa_ | 232 | Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu | 99.93 | |
| d3d24a1 | 227 | Steroid hormone receptor ERR1 {Human (Homo sapiens | 99.52 | |
| d2e2ra1 | 223 | Orphan nuclear receptor ERR3 {Human (Homo sapiens) | 99.51 | |
| d1ovla_ | 236 | Orphan nuclear receptor NURR1 {Human (Homo sapiens | 99.51 | |
| d1pzla_ | 233 | Hepatocyte nuclear factor 4-alpha {Human (Homo sap | 99.49 | |
| d1n46a_ | 251 | Thyroid hormone receptor beta (TR-beta) {Human (Ho | 99.48 | |
| d1xnxa_ | 232 | Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu | 99.48 | |
| d1pq9a_ | 239 | Oxysterols receptor LXR-beta {Human (Homo sapiens) | 99.47 | |
| d2r40d1 | 243 | Ecdysone receptor {Noctuid moth (Heliothis viresce | 99.46 | |
| d1xvpb_ | 246 | Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s | 99.45 | |
| d1ie9a_ | 255 | Vitamin D nuclear receptor {Human (Homo sapiens) [ | 99.45 | |
| d1fcya_ | 236 | Retinoic acid receptor gamma (RAR-gamma) {Human (H | 99.44 | |
| d1pdua_ | 230 | Nuclear hormone receptor HR38 {Fruit fly (Drosophi | 99.44 | |
| d1g2na_ | 256 | Ultraspiracle protein, usp {Heliothis virescens [T | 99.43 | |
| d1xpca_ | 245 | Estrogen receptor alpha {Human (Homo sapiens) [Tax | 99.42 | |
| d1pk5a_ | 242 | Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus | 99.41 | |
| d2qw4a1 | 233 | Orphan nuclear receptor NR4A1 {Human (Homo sapiens | 99.41 | |
| d1nq7a_ | 244 | Orphan nuclear receptor ROR-beta {Rat (Rattus norv | 99.4 | |
| d2p54a1 | 267 | Peroxisome proliferator activated receptor alpha, | 99.39 | |
| d2j7ya1 | 236 | Estrogen receptor beta {Rat (Rattus norvegicus) [T | 99.39 | |
| d1hg4a_ | 265 | Ultraspiracle protein, usp {Drosophila melanogaste | 99.39 | |
| d1n83a_ | 251 | Orphan nuclear receptor ROR-alpha {Human (Homo sap | 99.38 | |
| d2p1ta1 | 230 | Retinoid-X receptor alpha (RXR-alpha) {Human (Homo | 99.37 | |
| d2fvja1 | 271 | Peroxisome proliferator activated receptor gamma, | 99.36 | |
| d1nrla_ | 292 | Pregnane x receptor, PXR {Human (Homo sapiens) [Ta | 99.35 | |
| d1t7ra_ | 250 | Androgen receptor {Chimpanzee (Pan troglodytes) [T | 99.34 | |
| d1osha_ | 231 | Bile acid receptor FXR {Human (Homo sapiens) [TaxI | 99.32 | |
| d2b50b1 | 265 | Peroxisome proliferator-activated receptor delta, | 99.32 | |
| d1nhza_ | 247 | Glucocorticoid receptor {Human (Homo sapiens) [Tax | 99.31 | |
| d1sqna_ | 251 | Progesterone receptor {Human (Homo sapiens) [TaxId | 99.3 |
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Nuclear receptor ligand-binding domain superfamily: Nuclear receptor ligand-binding domain family: Nuclear receptor ligand-binding domain domain: Ultraspiracle protein, usp species: Heliothis virescens [TaxId: 7102]
Probab=100.00 E-value=7.1e-34 Score=245.80 Aligned_cols=166 Identities=22% Similarity=0.295 Sum_probs=144.9
Q ss_pred ccccccccchhHHHHHHHHHHHHHHHHHhhhcCCCCCccccc-----------------cccccc-------hhHHHH-H
Q psy16761 73 KTAFTSRRELAGHLLLAESWRELFILGLAQYLPSLDLGELVE-----------------SCKSRH-------VDIEEE-V 127 (261)
Q Consensus 73 ~p~f~~L~~~dqv~lLq~~~~e~l~L~~a~~s~~~~~~~ll~-----------------~~~~~~-------~~~~~~-~ 127 (261)
.|+|..|+.+||+.++|.+|.+++++++||++.+........ ..+... .++.+. .
T Consensus 65 lP~F~~L~~~DQi~LLk~~w~el~iL~~a~rs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 144 (256)
T d1g2na_ 65 IPHFSQLEMEDQILLIKGSWNELLLFAIAWRSMEFLTEERDGVDGTGNRTTSPPQLMCLMPGMTLHRNSALQAGVGQIFD 144 (256)
T ss_dssp STTGGGSCHHHHHHHHHHHHHHHHHHHHHHHHGGGSCCC----------CCCCCCEEEEETTEEEEHHHHHHHTCHHHHH
T ss_pred CCChhhCCHHHHHHHHHHHHHHHHHHHHHHHHhhhccccccccccccccccCcchhhccCCCcccCHHHHHhcchHHHHH
Confidence 499999999999999999999999999999987654332211 111111 122232 3
Q ss_pred HHHHHHHHHHHhcCCChhhhhhhhHhhhcccCcccccccCCCCCCCCCCCCCCCcCcCcHHHHHHHHHHHHHHHHHHHHh
Q psy16761 128 IRFQSVLNEFKVLNIDPYEYDYIRAITLFKTVIEDEVKDNRSSSSSDDGSEHPESCLRDVIAIAAIQGHTQIFLNKYIHT 207 (261)
Q Consensus 128 ~~l~~~~~~l~~L~l~~~E~~lLkai~l~~pd~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~i~~lq~~~~~~L~~~~~~ 207 (261)
+.+.+++.+|++|++|.+||+|||||+||||| ++|+++.++|+++|++++.+|++||..
T Consensus 145 ~~l~~l~~~~~~L~ld~~E~~~LkaIvLfnpd---------------------~~gL~~~~~Ie~lqe~~~~aL~~y~~~ 203 (256)
T d1g2na_ 145 RVLSELSLKMRTLRVDQAEYVALKAIILLNPD---------------------VKGLKNRQEVEVLREKMFLCLDEYCRR 203 (256)
T ss_dssp HHHHHTHHHHHHTTCCHHHHHHHHHHHHSCTT---------------------CTTCSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHcCCCHHHHHHHHHHHHhcCc---------------------cCCcccHHHHHHHHHHHHHHHHHHHHh
Confidence 45779999999999999999999999999999 999999999999999999999999999
Q ss_pred cCCCCccHHHHHHhhcccccCCCcccchhhhcccccCCCCcHHHHHHHHHhcC
Q psy16761 208 VYPSQPTRFCKIQLILPRLKSIPSLVLEELFFRNIIGHNTTIKKTIWHMYKNA 260 (261)
Q Consensus 208 ~~~~~~~Rf~~LL~~Lp~Lr~~~~~~~e~l~f~~~~g~~~~i~~ll~eml~~~ 260 (261)
+||++|.||++||++||.||+++.+.+|++||.+++| ++||++++.|||++.
T Consensus 204 ~~p~~~~Rf~~LLl~Lp~LR~l~~~~~e~lff~~l~g-~~~i~~ll~eml~~~ 255 (256)
T d1g2na_ 204 SRSSEEGRFAALLLRLPALRSISLKSFEHLFFFHLVA-DTSIAGYIRDALRNH 255 (256)
T ss_dssp HSTTCTTHHHHHHTHHHHHHHHHHHHHHHHHHTTCBC-TTTHHHHHHHHHTCC
T ss_pred cCCChhhHHHHHHHHHHHHHHHHHHHHHHHhcccccC-CCChHHHHHHHHhcc
Confidence 9999999999999999999999999999999999999 999999999999874
|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|