Diaphorina citri psyllid: psy16775

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------

MFGSAAIQDVYQWKLLNHVARDHNMSLKPAHLSYKCTVCTATFGMYRQFENHVYSAHSVAPRRPATDKKPQGQSTDPMLKPLKINDEITIIPQPPRPTASSSSSTSSSNNNKVKITPDLEQLRNHMQWIHKVKIHPKMIYNRPPLNCQKCQFRFFTDQGLERHLLGSHGLVTSSMQEAANKGKDGGRCPVCGRVYQWKLLNHVARDHNMSLKPAHLSYKCTVCTATFGMYRQFENHVYSAHSVAPRRPATDKKPQGQSTDPMLKPLKINDEITIIPQPPRPTASSSSSTSSSNNNKVKITPVPSKK

cccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccccccccccHHcccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*****AIQDVYQWKLLNHVARDHNMSLKPAHLSYKCTVCTATFGMYRQFENHVYSAH******************************************************KVKITPDLEQLRNHMQWIHKVKIHPKMIYNRPPLNCQKCQFRFFTDQGLERHLLGSHGLVT*************GRCPVCGRVYQWKLLNHVARDHNMSLKPAHLSYKCTVCTATFGMYRQFENHVYSA******************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005700 [CC]	polytene chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0070615 [MF]	nucleosome-dependent ATPase activity	probable	GO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0048813 [BP]	dendrite morphogenesis	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0016581 [CC]	NuRD complex	probable	GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0017053, GO:0000118, GO:0090545, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 106-165,179-240
View the alignment between query and template
View the model in PyMOL

Template: 2GLI, chain A
Confidence level:confident
Coverage over the Query: 32-59,77-86,107-165,179-242
View the alignment between query and template
View the model in PyMOL

Template: 2I13, chain A
Confidence level:confident
Coverage over the Query: 43-56,105-165,179-255
View the alignment between query and template
View the model in PyMOL