Diaphorina citri psyllid: psy16776


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
QLNSKFYPPSNSTLVTVNRTINLISKNLQYNRKKNLYPLSNYTFDIKDPLFEKDSSVPARFQRMRDEFEKIGMRRSVDGVLLVHEHGLPHVLMLQLGTTFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWIVEDTIGNWWRPNFEPPQYPYVPVHITSPKEHRRLFLVQLPERVPKNYKLVAAPLVELYDNSQGYGPIISSLPQALCR
cccccccccccccccccccccccccccccccccEEEEEcccCEECcccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEEEccCEEECccccccccccHHHHHHHHHHHHccccccccccEEEEEEEEEEccccccccccccccccccccccEEEEEEEEcccccccccEEEccccHHHcccccccccEEccccccccc
***************T***TINLISKNLQYNRKKNLYPLSNYTFDIKDPLFE********FQRMRDEFEKIGMRRSVDGVLLVHEHGLPHVLMLQLGTTFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWIVEDTIGNWWRPNFEPPQYPYVPVHITSPKEHRRLFLVQLPERVPKNYKLVAAPLVELYDNSQGYGPIISSLPQALC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QLNSKFYPPSNSTLVTVNRTINLISKNLQYNRKKNLYPLSNYTFDIKDPLFEKDSSVPARFQRMRDEFEKIGMRRSVDGVLLVHEHGLPHVLMLQLGTTFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWIVEDTIGNWWRPNFEPPQYPYVPVHITSPKEHRRLFLVQLPERVPKNYKLVAAPLVELYDNSQGYGPIISSLPQALCR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cleavage and polyadenylation specificity factor subunit 5 Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export.very confidentQ5RAI8
Cleavage and polyadenylation specificity factor subunit 5 Mediates sequence-specific recognition of 5'-UGUA-3' elements within the pre-mRNA. Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing.very confidentQ7T3C6
Cleavage and polyadenylation specificity factor subunit 5 Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export.very confidentQ3ZCA2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042382 [CC]paraspecklesconfidentGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005849 [CC]mRNA cleavage factor complexconfidentGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0017091 [MF]AU-rich element bindingconfidentGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0003729 [MF]mRNA bindingconfidentGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005813 [CC]centrosomeconfidentGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0051262 [BP]protein tetramerizationconfidentGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000398 [BP]mRNA splicing, via spliceosomeconfidentGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0006378 [BP]mRNA polyadenylationconfidentGO:0090304, GO:0034641, GO:0006807, GO:0043631, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0031124, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0006379 [BP]mRNA cleavageconfidentGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0090305, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0046483, GO:0071704, GO:0006396, GO:0006397
GO:0006369 [BP]termination of RNA polymerase II transcriptionconfidentGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0006353, GO:0019438
GO:0042826 [MF]histone deacetylase bindingconfidentGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0016787 [MF]hydrolase activityconfidentGO:0003824, GO:0003674
GO:0042803 [MF]protein homodimerization activityconfidentGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0016246 [BP]RNA interferenceprobableGO:0010605, GO:0019222, GO:0035194, GO:0010608, GO:0009987, GO:0040029, GO:0050789, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0044763, GO:0031047, GO:0010629, GO:0048519, GO:0016441, GO:0009892, GO:0010468, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BHO, chain A
Confidence level:very confident
Coverage over the Query: 24-214
View the alignment between query and template
View the model in PyMOL