Psyllid ID: psy16776
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 116007798 | 237 | CG3689, isoform C [Drosophila melanogast | 0.920 | 0.831 | 0.810 | 2e-91 | |
| 157105268 | 230 | pre-mrna cleavage factor im, 25kD subuni | 0.929 | 0.865 | 0.798 | 3e-91 | |
| 340716896 | 228 | PREDICTED: cleavage and polyadenylation | 0.887 | 0.833 | 0.819 | 8e-91 | |
| 66499810 | 228 | PREDICTED: cleavage and polyadenylation | 0.887 | 0.833 | 0.819 | 9e-91 | |
| 307193774 | 228 | Cleavage and polyadenylation specificity | 0.887 | 0.833 | 0.819 | 9e-91 | |
| 332021628 | 228 | Cleavage and polyadenylation specificity | 0.887 | 0.833 | 0.819 | 1e-90 | |
| 307179524 | 222 | Cleavage and polyadenylation specificity | 0.859 | 0.828 | 0.845 | 2e-90 | |
| 118778290 | 231 | AGAP007242-PA [Anopheles gambiae str. PE | 0.887 | 0.822 | 0.819 | 3e-90 | |
| 345479668 | 225 | PREDICTED: cleavage and polyadenylation | 0.859 | 0.817 | 0.845 | 1e-89 | |
| 114051528 | 227 | cleavage and polyadenylation specific fa | 0.887 | 0.837 | 0.814 | 1e-88 |
| >gi|116007798|ref|NP_001036597.1| CG3689, isoform C [Drosophila melanogaster] gi|113194891|gb|ABI31246.1| CG3689, isoform C [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Score = 340 bits (872), Expect = 2e-91, Method: Compositional matrix adjust.
Identities = 163/201 (81%), Positives = 179/201 (89%), Gaps = 4/201 (1%)
Query: 18 NRTINLISKNLQYNRKKNLYPLSNYTFDIKDPLFEKDSSVPARFQRMRDEFEKIGMRRSV 77
N T ++ L NR NLYPL+NYTF K+PLFEKD SVP+RFQRMR+EF++IGMRRSV
Sbjct: 31 NGTQKYTNQALTINRTINLYPLTNYTFGTKEPLFEKDPSVPSRFQRMREEFDRIGMRRSV 90
Query: 78 DGVLLVHEHGLPHVLMLQLGTTFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWI 137
+GVLLVHEHGLPHVL+LQLGTTFFKLPGGELN GEDE+EGLKRLLS+TLGR+DGVKQEWI
Sbjct: 91 EGVLLVHEHGLPHVLLLQLGTTFFKLPGGELNAGEDEVEGLKRLLSETLGRQDGVKQEWI 150
Query: 138 VEDTIGNWWRPNFEPPQYPYVPVHITSPKEHRRLFLVQLPER----VPKNYKLVAAPLVE 193
VEDTIGNWWRPNFEPPQYPY+P HIT PKEH+RLFLVQL E+ VPKNYKLVAAPL E
Sbjct: 151 VEDTIGNWWRPNFEPPQYPYIPPHITKPKEHKRLFLVQLHEKALFAVPKNYKLVAAPLFE 210
Query: 194 LYDNSQGYGPIISSLPQALCR 214
LYDNSQGYGPIISSLPQALCR
Sbjct: 211 LYDNSQGYGPIISSLPQALCR 231
|
Source: Drosophila melanogaster Species: Drosophila melanogaster Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157105268|ref|XP_001648792.1| pre-mrna cleavage factor im, 25kD subunit [Aedes aegypti] gi|157118316|ref|XP_001653167.1| pre-mrna cleavage factor im, 25kD subunit [Aedes aegypti] gi|108880136|gb|EAT44361.1| AAEL004266-PA [Aedes aegypti] gi|108883290|gb|EAT47515.1| AAEL001371-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|340716896|ref|XP_003396927.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like isoform 1 [Bombus terrestris] gi|340716898|ref|XP_003396928.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|66499810|ref|XP_624522.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like isoform 2 [Apis mellifera] gi|350396581|ref|XP_003484601.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Bombus impatiens] gi|380019194|ref|XP_003693499.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Apis florea] gi|383853072|ref|XP_003702048.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307193774|gb|EFN76452.1| Cleavage and polyadenylation specificity factor subunit 5 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332021628|gb|EGI61987.1| Cleavage and polyadenylation specificity factor subunit 5 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307179524|gb|EFN67838.1| Cleavage and polyadenylation specificity factor subunit 5 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|118778290|ref|XP_308558.3| AGAP007242-PA [Anopheles gambiae str. PEST] gi|116132312|gb|EAA04203.3| AGAP007242-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|345479668|ref|XP_003424005.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|114051528|ref|NP_001040354.1| cleavage and polyadenylation specific factor 5 [Bombyx mori] gi|95102614|gb|ABF51245.1| cleavage and polyadenylation specific factor 5 [Bombyx mori] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| FB|FBgn0035987 | 237 | CG3689 [Drosophila melanogaste | 0.920 | 0.831 | 0.810 | 2.9e-87 | |
| ZFIN|ZDB-GENE-040426-1316 | 228 | cpsf5 "cleavage and polyadenyl | 0.920 | 0.864 | 0.741 | 4.1e-81 | |
| UNIPROTKB|Q6DJE4 | 227 | cpsf5 "Cleavage and polyadenyl | 0.887 | 0.837 | 0.747 | 1.2e-79 | |
| UNIPROTKB|Q3ZCA2 | 227 | NUDT21 "Cleavage and polyadeny | 0.887 | 0.837 | 0.747 | 2.6e-79 | |
| UNIPROTKB|E2QUJ4 | 227 | NUDT21 "Uncharacterized protei | 0.887 | 0.837 | 0.747 | 2.6e-79 | |
| UNIPROTKB|O43809 | 227 | NUDT21 "Cleavage and polyadeny | 0.887 | 0.837 | 0.747 | 2.6e-79 | |
| UNIPROTKB|Q5RAI8 | 227 | NUDT21 "Cleavage and polyadeny | 0.887 | 0.837 | 0.747 | 2.6e-79 | |
| MGI|MGI:1915469 | 227 | Nudt21 "nudix (nucleoside diph | 0.887 | 0.837 | 0.747 | 2.6e-79 | |
| RGD|1305766 | 227 | Nudt21 "nudix (nucleoside diph | 0.887 | 0.837 | 0.747 | 2.6e-79 | |
| UNIPROTKB|E2R7S0 | 234 | LOC100684233 "Uncharacterized | 0.925 | 0.846 | 0.712 | 7.9e-78 |
| FB|FBgn0035987 CG3689 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 872 (312.0 bits), Expect = 2.9e-87, P = 2.9e-87
Identities = 163/201 (81%), Positives = 179/201 (89%)
Query: 18 NRTINLISKNLQYNRKKNLYPLSNYTFDIKDPLFEKDSSVPARFQRMRDEFEKIGMRRSV 77
N T ++ L NR NLYPL+NYTF K+PLFEKD SVP+RFQRMR+EF++IGMRRSV
Sbjct: 31 NGTQKYTNQALTINRTINLYPLTNYTFGTKEPLFEKDPSVPSRFQRMREEFDRIGMRRSV 90
Query: 78 DGVLLVHEHGLPHVLMLQLGTTFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWI 137
+GVLLVHEHGLPHVL+LQLGTTFFKLPGGELN GEDE+EGLKRLLS+TLGR+DGVKQEWI
Sbjct: 91 EGVLLVHEHGLPHVLLLQLGTTFFKLPGGELNAGEDEVEGLKRLLSETLGRQDGVKQEWI 150
Query: 138 VEDTIGNWWRPNFEPPQYPYVPVHITSPKEHRRLFLVQLPER----VPKNYKLVAAPLVE 193
VEDTIGNWWRPNFEPPQYPY+P HIT PKEH+RLFLVQL E+ VPKNYKLVAAPL E
Sbjct: 151 VEDTIGNWWRPNFEPPQYPYIPPHITKPKEHKRLFLVQLHEKALFAVPKNYKLVAAPLFE 210
Query: 194 LYDNSQGYGPIISSLPQALCR 214
LYDNSQGYGPIISSLPQALCR
Sbjct: 211 LYDNSQGYGPIISSLPQALCR 231
|
|
| ZFIN|ZDB-GENE-040426-1316 cpsf5 "cleavage and polyadenylation specific factor 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6DJE4 cpsf5 "Cleavage and polyadenylation specificity factor subunit 5" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZCA2 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUJ4 NUDT21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43809 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RAI8 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915469 Nudt21 "nudix (nucleoside diphosphate linked moiety X)-type motif 21" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305766 Nudt21 "nudix (nucleoside diphosphate linked moiety X)-type motif 21" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R7S0 LOC100684233 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| pfam13869 | 188 | pfam13869, NUDIX_2, Nucleotide hydrolase | 1e-104 |
| >gnl|CDD|206040 pfam13869, NUDIX_2, Nucleotide hydrolase | Back alignment and domain information |
|---|
Score = 298 bits (765), Expect = e-104
Identities = 117/184 (63%), Positives = 139/184 (75%), Gaps = 4/184 (2%)
Query: 35 NLYPLSNYTFDIKDPLFEKDSSVPARFQRMRDEFEKIGMRRSVDGVLLVHEHGLPHVLML 94
+LYPLSNYTF K+ L EKD SV R +R+++ +EK GMRRSV+GVLLVH HG PHVL+L
Sbjct: 4 DLYPLSNYTFGTKEALVEKDISVAERLKRLKNNYEKNGMRRSVEGVLLVHRHGHPHVLLL 63
Query: 95 QLGTTFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWIVEDTIGNWWRPNFEPPQ 154
Q+G TFFKLPGG L GEDEIEGLKR L+ L DGV+++W V + +G WWRPNFE
Sbjct: 64 QIGNTFFKLPGGRLRPGEDEIEGLKRKLAKKLSPEDGVEEDWEVGECLGEWWRPNFETSM 123
Query: 155 YPYVPVHITSPKEHRRLFLVQLPER----VPKNYKLVAAPLVELYDNSQGYGPIISSLPQ 210
YPY+P HIT PKE +L+LVQLPE+ VPKN KL+A PL ELYDN+ YGPIISSLP
Sbjct: 124 YPYLPAHITKPKECIKLYLVQLPEKCKFAVPKNMKLLAVPLFELYDNAAKYGPIISSLPH 183
Query: 211 ALCR 214
L R
Sbjct: 184 LLSR 187
|
Nudix hydrolases are found in all classes of organism and hydrolyse a wide range of organic pyrophosphates, including nucleoside di- and triphosphates, di-nucleoside and diphospho-inositol polyphosphates, nucleotide sugars and RNA caps, with varying degrees of substrate specificity. Length = 188 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| KOG1689|consensus | 221 | 100.0 | ||
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 100.0 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.13 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.11 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.11 | |
| PLN02709 | 222 | nudix hydrolase | 99.08 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.08 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.07 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.05 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.03 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.03 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.02 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.01 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.0 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 98.99 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 98.98 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 98.97 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 98.97 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 98.96 | |
| PLN02325 | 144 | nudix hydrolase | 98.96 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 98.95 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 98.95 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 98.95 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 98.95 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 98.94 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 98.94 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 98.93 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 98.9 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 98.89 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 98.88 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 98.88 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 98.88 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 98.88 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 98.87 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 98.87 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 98.87 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 98.86 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 98.85 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 98.85 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 98.83 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 98.82 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 98.8 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 98.8 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 98.8 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 98.78 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 98.78 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 98.78 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 98.74 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 98.74 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 98.73 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 98.72 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 98.71 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 98.69 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 98.69 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 98.69 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 98.66 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 98.64 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 98.64 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 98.63 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 98.63 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 98.62 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 98.62 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 98.62 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 98.61 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 98.56 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 98.54 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 98.51 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 98.51 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 98.45 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 98.43 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 98.39 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 98.35 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 98.32 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 98.31 | |
| KOG2839|consensus | 145 | 98.3 | ||
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 98.23 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 98.11 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 98.06 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 98.0 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 97.99 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 97.79 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 97.57 | |
| KOG3069|consensus | 246 | 97.54 | ||
| PLN02791 | 770 | Nudix hydrolase homolog | 97.31 | |
| KOG3041|consensus | 225 | 97.22 | ||
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 96.95 | |
| KOG0648|consensus | 295 | 96.52 | ||
| KOG4195|consensus | 275 | 96.38 | ||
| KOG3084|consensus | 345 | 96.37 | ||
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 96.34 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 96.26 | |
| PLN02839 | 372 | nudix hydrolase | 94.06 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 93.17 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 91.21 |
| >KOG1689|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-89 Score=576.68 Aligned_cols=199 Identities=63% Similarity=1.108 Sum_probs=192.1
Q ss_pred EeeeeeeeeccccccccceeEeecCceEeccCCCcccCCCChHHHHHHhHHHHhhcCceeEEEEEEEEecCCCCEEEEEE
Q psy16776 16 TVNRTINLISKNLQYNRKKNLYPLSNYTFDIKDPLFEKDSSVPARFQRMRDEFEKIGMRRSVDGVLLVHEHGLPHVLMLQ 95 (214)
Q Consensus 16 ~~~~~~~~~~~~~~~~~~~~iYpl~nY~F~~k~~~~ekd~sv~~Rl~rl~~~y~~~GmRrsV~aVilvh~~~~phVLLLQ 95 (214)
.++..++-..+...++++|++||||||+||+||++.|||+||++||+||+.+|++.||||||+||++||+|++|||||||
T Consensus 11 ~~~~~~~~~~~~~~~~~~vn~YPLsnYtFGtKe~~~eKD~svadrf~rmk~ey~k~gmRrsvegvlivheH~lPHvLLLQ 90 (221)
T KOG1689|consen 11 EEISDNTTRRNDVVHDRTVNLYPLSNYTFGTKEALREKDESVADRFARMKIEYMKEGMRRSVEGVLIVHEHNLPHVLLLQ 90 (221)
T ss_pred ccccccccccCCcchhheeeeeecccccccccchhhhccchHHHHHHHHHHHHHhhhhhheeeeeEEEeecCCCeEEEEe
Confidence 34444444567889999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCceeeeCCccccCCCCHHHHHHHHHHhhhCCCCCCccceEEeceEEEEecCCCCCCCCCCCCCCCCCccceeEEEeee
Q psy16776 96 LGTTFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWIVEDTIGNWWRPNFEPPQYPYVPVHITSPKEHRRLFLVQ 175 (214)
Q Consensus 96 ~~~~~f~LPGGrle~GE~e~egLkReL~EeLg~~~~~~~~~eVge~lg~wwRp~Fe~~~yPYlP~Hit~PKE~~klf~V~ 175 (214)
.+++||+||||+++|||+|++||+|.|+|.||..||...+|.||||||+|||||||+.||||+|||||+||||+|||+||
T Consensus 91 ig~tf~KLPGG~L~pGE~e~~Gl~r~l~~~Lgr~dg~~~dwtv~ecig~WWRPNFe~~~YPyiP~hitkPKeh~kL~lV~ 170 (221)
T KOG1689|consen 91 IGNTFFKLPGGRLRPGEDEADGLKRLLTESLGRSDGLVIDWTVGECIGNWWRPNFETPMYPYIPPHITKPKEHTKLFLVQ 170 (221)
T ss_pred eCCEEEecCCCccCCCcchhHHHHHHHHHHhcccccccccccHhhhhhcccCCCCCCcccCCCCcccCCchhccEEEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCC----CCCCceEEeecccccccCCCCccceeecccccccC
Q psy16776 176 LPER----VPKNYKLVAAPLVELYDNSQGYGPIISSLPQALCR 214 (214)
Q Consensus 176 Lpe~----vp~n~kL~AvPLfely~N~~~yG~~is~iP~llSr 214 (214)
||++ ||||+||+||||||||||++.||||||+||++|||
T Consensus 171 L~~k~~F~VPKN~KLlA~PLfeLydN~~~yGPiiSslp~~lsr 213 (221)
T KOG1689|consen 171 LPEKQQFAVPKNFKLLAVPLFELYDNAKTYGPIISSLPKLLSR 213 (221)
T ss_pred ccccceEeccCCceeeeeeHhhhhhccccccchhHHHHHHHhh
Confidence 9999 99999999999999999999999999999999997
|
|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2839|consensus | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >KOG3069|consensus | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >KOG3041|consensus | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >KOG0648|consensus | Back alignment and domain information |
|---|
| >KOG4195|consensus | Back alignment and domain information |
|---|
| >KOG3084|consensus | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 214 | ||||
| 2j8q_A | 227 | Crystal Structure Of Human Cleavage And Polyadenyla | 5e-85 | ||
| 2cl3_A | 230 | Crystal Structure Of Human Cleavage And Polyadenyla | 5e-85 | ||
| 3bho_A | 208 | Crystal Structure Of The 25kda Subunit Of Human Cle | 9e-85 | ||
| 3q2s_A | 207 | Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Lengt | 1e-84 | ||
| 3mdg_A | 227 | Crystal Structure Of The 25kda Subunit Of Human Cle | 1e-84 | ||
| 3p5t_A | 202 | Cfim25-Cfim68 Complex Length = 202 | 6e-84 | ||
| 3bap_A | 227 | Crystal Structure Of The 25 Kda Subunit Of Human Cl | 2e-82 |
| >pdb|2J8Q|A Chain A, Crystal Structure Of Human Cleavage And Polyadenylation Specificity Factor 5 (Cpsf5) In Complex With A Sulphate Ion. Length = 227 | Back alignment and structure |
|
| >pdb|2CL3|A Chain A, Crystal Structure Of Human Cleavage And Polyadenylation Specificity Factor 5 (Cpsf5) Length = 230 | Back alignment and structure |
| >pdb|3BHO|A Chain A, Crystal Structure Of The 25kda Subunit Of Human Cleavage Factor Im With Ap4a Length = 208 | Back alignment and structure |
| >pdb|3Q2S|A Chain A, Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Length = 207 | Back alignment and structure |
| >pdb|3MDG|A Chain A, Crystal Structure Of The 25kda Subunit Of Human Cleavage Factor Im In Complex With Rna Uuguau Length = 227 | Back alignment and structure |
| >pdb|3P5T|A Chain A, Cfim25-Cfim68 Complex Length = 202 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 1e-94 |
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Length = 208 | Back alignment and structure |
|---|
Score = 273 bits (700), Expect = 1e-94
Identities = 145/194 (74%), Positives = 169/194 (87%), Gaps = 4/194 (2%)
Query: 25 SKNLQYNRKKNLYPLSNYTFDIKDPLFEKDSSVPARFQRMRDEFEKIGMRRSVDGVLLVH 84
+K L R NLYPL+NYTF K+PL+EKDSSV ARFQRMR+EF+KIGMRR+V+GVL+VH
Sbjct: 9 TKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVH 68
Query: 85 EHGLPHVLMLQLGTTFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWIVEDTIGN 144
EH LPHVL+LQLGTTFFKLPGGELN GEDE+EGLKRL+++ LGR+DGV Q+W+++D IGN
Sbjct: 69 EHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGN 128
Query: 145 WWRPNFEPPQYPYVPVHITSPKEHRRLFLVQLPER----VPKNYKLVAAPLVELYDNSQG 200
WWRPNFEPPQYPY+P HIT PKEH++LFLVQL E+ VPKNYKLVAAPL ELYDN+ G
Sbjct: 129 WWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPG 188
Query: 201 YGPIISSLPQALCR 214
YGPIISSLPQ L R
Sbjct: 189 YGPIISSLPQLLSR 202
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 100.0 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.32 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.17 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.16 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.14 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.1 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.1 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.09 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.08 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.06 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.05 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.05 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.03 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.03 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.03 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.03 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.02 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.0 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 98.99 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 98.98 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 98.98 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 98.97 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 98.97 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 98.96 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 98.95 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 98.94 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 98.94 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 98.94 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 98.94 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 98.94 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 98.94 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 98.92 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 98.92 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 98.91 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 98.9 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 98.9 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 98.89 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 98.89 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 98.87 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 98.86 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 98.86 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 98.86 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 98.85 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 98.84 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 98.83 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 98.82 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 98.8 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 98.8 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 98.78 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 98.77 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 98.76 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 98.75 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 98.75 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 98.72 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 98.71 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 98.71 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 98.65 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 98.64 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 98.63 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 98.63 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 98.63 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 98.63 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 98.62 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 98.6 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 98.58 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 98.57 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 98.55 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 98.47 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 98.47 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 98.46 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 98.27 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 98.22 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 98.19 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 98.0 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 97.91 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 97.63 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 97.53 |
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-85 Score=565.09 Aligned_cols=191 Identities=76% Similarity=1.339 Sum_probs=182.3
Q ss_pred eccccccccceeEeecCceEeccCCCcccCCCChHHHHHHhHHHHhhcCceeEEEEEEEEecCCCCEEEEEEccCceeee
Q psy16776 24 ISKNLQYNRKKNLYPLSNYTFDIKDPLFEKDSSVPARFQRMRDEFEKIGMRRSVDGVLLVHEHGLPHVLMLQLGTTFFKL 103 (214)
Q Consensus 24 ~~~~~~~~~~~~iYpl~nY~F~~k~~~~ekd~sv~~Rl~rl~~~y~~~GmRrsV~aVilvh~~~~phVLLLQ~~~~~f~L 103 (214)
.+.+++++++|+||||+||+||+||++.|||+++.+||+||+++|++.|||++|+|||+||+|++|||||+|+++++|+|
T Consensus 8 ~~~~~~~~~~~~iYplsnY~f~~k~~~~ekd~s~~~r~~rl~~~y~~~g~R~sV~avil~~~~~~phVLLlq~~~~~f~L 87 (208)
T 3bho_A 8 QTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKL 87 (208)
T ss_dssp CCCCTTTCCEEEECBGGGEEEEEECCCCCSCSSHHHHHHHHHHHHHHHCSEEEEEEEEEEEETTEEEEEEEEEETTEEEC
T ss_pred CCCCccccceEEEecccceeEccCCccccccccHHHHHHHHHHHHHhhCCceEEEEEEEEcCCCCcEEEEEEcCCCcEEC
Confidence 35568889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCccccCCCCHHHHHHHHHHhhhCCCCCCccceEEeceEEEEecCCCCCCCCCCCCCCCCCccceeEEEeeeCCCC----
Q psy16776 104 PGGELNQGEDEIEGLKRLLSDTLGRRDGVKQEWIVEDTIGNWWRPNFEPPQYPYVPVHITSPKEHRRLFLVQLPER---- 179 (214)
Q Consensus 104 PGGrle~GE~e~egLkReL~EeLg~~~~~~~~~eVge~lg~wwRp~Fe~~~yPYlP~Hit~PKE~~klf~V~Lpe~---- 179 (214)
|||++++||++++||+|||.||||.+++...+|+||||||+||||+||++||||+||||||||||+|||+|+|||+
T Consensus 88 PGGkle~gE~~~eaL~REL~EELg~~~~~~~~~eIge~lg~wwRp~fet~~YPYlP~Hit~pKE~~kly~V~Lp~~~~f~ 167 (208)
T 3bho_A 88 PGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFA 167 (208)
T ss_dssp SEEECCTTCCHHHHHHHHHHHHHCCCC-----CEEEEEEEEEEECSSSSCCBSSCCTTCCSCSEEEEEEEEECCSSEEEE
T ss_pred CCcccCCCCCHHHHHHHHHHHHhCCCcCCCccEEEhheEEEEecCCCCCcCCCCCCcccCchhhheeeeeEecCccceEe
Confidence 9999999999999999999999998778889999999999999999999999999999999999999999999999
Q ss_pred CCCCceEEeecccccccCCCCccceeecccccccC
Q psy16776 180 VPKNYKLVAAPLVELYDNSQGYGPIISSLPQALCR 214 (214)
Q Consensus 180 vp~n~kL~AvPLfely~N~~~yG~~is~iP~llSr 214 (214)
|||||||+||||||||||+++||++||||||+|||
T Consensus 168 vPkn~kL~AvPLfely~N~~~yG~~issiP~llSR 202 (208)
T 3bho_A 168 VPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSR 202 (208)
T ss_dssp EETTCEEEEEEHHHHTTCHHHHHHHHTTHHHHHTT
T ss_pred cCCCCeEEeecHHhhhcchhhhchhhhhhhhhhhh
Confidence 99999999999999999999999999999999998
|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.26 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.26 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.22 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.16 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.15 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.12 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.12 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.12 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.05 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.04 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.04 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.01 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.0 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 98.99 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 98.95 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 98.89 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 98.89 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 98.84 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 98.79 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 98.7 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 98.54 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 98.54 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 98.53 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 98.5 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 98.49 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 98.3 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 98.03 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 97.86 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 97.47 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 97.09 |
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: Coenzyme A pyrophosphatase species: Deinococcus radiodurans [TaxId: 1299]
Probab=99.26 E-value=1.2e-12 Score=106.79 Aligned_cols=101 Identities=21% Similarity=0.260 Sum_probs=69.2
Q ss_pred hhcCceeEEEEEEEEecCCCCEEEEEEccC------ceeeeCCccccCCCCHHHHHHHHHHhhhCCCCCC----------
Q psy16776 69 EKIGMRRSVDGVLLVHEHGLPHVLMLQLGT------TFFKLPGGELNQGEDEIEGLKRLLSDTLGRRDGV---------- 132 (214)
Q Consensus 69 ~~~GmRrsV~aVilvh~~~~phVLLLQ~~~------~~f~LPGGrle~GE~e~egLkReL~EeLg~~~~~---------- 132 (214)
...+.|+++++|+++. ++.++||+.||+. |.|.||||++++||+..+|+.||+.||+|.....
T Consensus 26 ~~~~~r~aaVlv~~~~-~~~~~vll~kR~~~l~~h~G~~~fPGG~~e~~E~~~~aAlRE~~EE~Gl~~~~~~~lg~l~~~ 104 (187)
T d1nqza_ 26 ELPHYRRAAVLVALTR-EADPRVLLTVRSSELPTHKGQIAFPGGSLDAGETPTQAALREAQEEVALDPAAVTLLGELDDV 104 (187)
T ss_dssp ----CEEEEEEEEEES-SSSCBBCEEEEC------CCCEECSEEECCTTCCHHHHHHHHHHHHHCCCGGGCEEEEECCCE
T ss_pred cCCCCCccEEEEEEEE-CCCCEEEEEEcCCCCCCCCCeEeCCccccccCCchhHHHHHHHHHhhccccceeEEeecccce
Confidence 3346799999999985 5679999999973 7999999999999999999999999999974210
Q ss_pred --ccceEEeceEEEEecCCCCCCCCCCCCCCCCCccceeEEEeeeCCCC
Q psy16776 133 --KQEWIVEDTIGNWWRPNFEPPQYPYVPVHITSPKEHRRLFLVQLPER 179 (214)
Q Consensus 133 --~~~~eVge~lg~wwRp~Fe~~~yPYlP~Hit~PKE~~klf~V~Lpe~ 179 (214)
...+.|..++|.+ .+. .+..+..+.|+.+++.|.|.+-
T Consensus 105 ~~~~~~~V~p~v~~l-~~~--------~~~~~~~~~EV~~v~~vpl~~L 144 (187)
T d1nqza_ 105 FTPVGFHVTPVLGRI-APE--------ALDTLRVTPEVAQIITPTLAEL 144 (187)
T ss_dssp EETTTEEEEEEEEEE-CGG--------GGGGCCCCTTEEEEECCBHHHH
T ss_pred eeccccEEEEEEEEE-CCc--------cccccccCCcceEEEeccHHHH
Confidence 1123333334322 111 1223445679999998877544
|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|