Diaphorina citri psyllid: psy16788


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MRCLLMVVTVLATLNSITISTTSAEDSVQLDKKALQQVESNLLSLFGLNRRPRPNRKNVRIPKAMLDLYKLQTGQDVDTSMLPLPGRHTRSANTVRTFTHQVTNIDKRFKYLNKFRLHFDVTSLPDTERVQSAELRLSRPMNYEEDKHEQIQRIIVKDILQPGIKGISKPVLRIVDSVLVDSTSGENGVSLDVLPAVQRWTKSPEHNHGLLIEVTNRDGVLLDRNIRPLVVMKRDQEEYNDLEWTSLEPILFLYSDDGRNKQKSLEDLLKRPRRTPNDNAPRKHKKNTYSICKRHPLYVDFADVGWNDWIVENIRKILIPYRHPLYVDFADVGWNDWIVAPPGYDAFVCKGDCPFPLAEHLNSTNHAIVQTLMNSVQPETVPKACCVPTALSAISMLYLDEDNKVVLKTYQDMAVTGCGCRYN
cEEEHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccEEEEEcccccccccccccccEEEEEEEcccccccccEEEEEEEEEccccccccccccEEEEEEEEEEccccccccccEEEEEEEEEEEcccccccEEEcccHHHHHHHHccccccCEEEEEEccccccccccccccEEccccccccccccccccccEEEEcccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHccccccccCEECcEEEEcccccccCEEcccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEEEccccEEEccccccEEEccccccc
MRCLLMVVTVLATLNSITI*********************NLLSLFGL***********RIPKAMLDLYKLQTGQ****************ANTVRTFTHQVTNIDKRFKYLNKFRLHFDVTSLPDTERVQSAELRLSRPMNYE***HEQIQRIIVKDILQPGIKGISKPVLRIVDSVLVDSTSGENGVSLDVLPAVQRWTKSPEHNHGLLIEVTNRDGVLLDRNIRPLVVMKRD*E**NDLEWTSLEPILFLYS************************************CKRHPLYVDFADVGWNDWIVENIRKILIPYRHPLYVDFADVGWNDWIVAPPGYDAFVCKGDCPFPLAEHLNSTNHAIVQTLMNSVQPETVPKACCVPTALSAISMLYLDEDNKVVLKTYQDMAVTGCGCRY*
xxxxxxxxxxHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRCLLMVVTVLATLNSITISTTSAEDSVQLDKKALQQVESNLLSLFGLNRRPRPNRKNVRIPKAMLDLYKLQTGQDVDTSMLPLPGRHTRSANTVRTFTHQVTNIDKRFKYLNKFRLHFDVTSLPDTERVQSAELRLSRPMNYEEDKHEQIQRIIVKDILQPGIKGISKPVLRIVDSVLVDSTSGENGVSLDVLPAVQRWTKSPEHNHGLLIEVTNRDGVLLDRNIRPLVVMKRDQEEYNDLEWTSLEPILFLYSDDGRNKQKSLEDLLKRPRRTPNDNAPRKHKKNTYSICKRHPLYVDFADVGWNDWIVENIRKILIPYRHPLYVDFADVGWNDWIVAPPGYDAFVCKGDCPFPLAEHLNSTNHAIVQTLMNSVQPETVPKACCVPTALSAISMLYLDEDNKVVLKTYQDMAVTGCGCRYN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bone morphogenetic protein 2 Induces cartilage and bone formation.confidentP49001
Bone morphogenetic protein 4 Induces cartilage and bone formation. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction.confidentO46576
Bone morphogenetic protein 2 Induces cartilage and bone formation.confidentP21274

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017015 [BP]regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090092, GO:0009966, GO:0048583, GO:0090287, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0032924 [BP]activin receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699, GO:0007178
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0001570 [BP]vasculogenesisprobableGO:0032502, GO:0032501, GO:0048856, GO:0044707, GO:0008150, GO:0048869, GO:0001568, GO:0030154, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0044699, GO:0048731, GO:0044763, GO:0009987, GO:0009653, GO:0007275, GO:0048646
GO:0045666 [BP]positive regulation of neuron differentiationprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0010862 [BP]positive regulation of pathway-restricted SMAD protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0010647, GO:0010646, GO:0050789, GO:0080090, GO:0010604, GO:0090100, GO:0009966, GO:0009967, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0090092, GO:0045937, GO:0060255, GO:0031323, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0060393, GO:0001932, GO:0001934, GO:0048522
GO:0043524 [BP]negative regulation of neuron apoptotic processprobableGO:0010941, GO:0060548, GO:0043066, GO:0050794, GO:0008150, GO:0043067, GO:0043523, GO:0065007, GO:0048523, GO:0048519, GO:1901214, GO:1901215, GO:0042981, GO:0050789, GO:0043069
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0060562 [BP]epithelial tube morphogenesisprobableGO:0032502, GO:0002009, GO:0048856, GO:0035239, GO:0044707, GO:0060429, GO:0009888, GO:0044767, GO:0032501, GO:0008150, GO:0048729, GO:0035295, GO:0009653, GO:0007275, GO:0044699
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0030509 [BP]BMP signaling pathwayprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0007178, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0045603 [BP]positive regulation of endothelial cell differentiationprobableGO:0051094, GO:0050793, GO:0045595, GO:0050794, GO:0045597, GO:0045601, GO:0065007, GO:0030856, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0030858, GO:0050789, GO:0048522
GO:0040008 [BP]regulation of growthprobableGO:0008150, GO:0065007, GO:0050789
GO:0050680 [BP]negative regulation of epithelial cell proliferationprobableGO:0042127, GO:0008285, GO:0050678, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0030513 [BP]positive regulation of BMP signaling pathwayprobableGO:0090092, GO:0010646, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0050789, GO:0030510
GO:0060389 [BP]pathway-restricted SMAD protein phosphorylationprobableGO:0016310, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0044267, GO:0051716, GO:0044260, GO:0071704, GO:0065007, GO:0006468, GO:0044238, GO:0009987, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0007154, GO:0007178, GO:0044700, GO:0019538, GO:0050896, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H62, chain A
Confidence level:very confident
Coverage over the Query: 289-301,330-421
View the alignment between query and template
View the model in PyMOL
Template: 3RJR, chain A
Confidence level:very confident
Coverage over the Query: 18-301,330-421
View the alignment between query and template
View the model in PyMOL