Diaphorina citri psyllid: psy1680


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
YGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGPNRSNSMNDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL
ccccccccccccccEEEEccccccccHHHHHHHcccccEEEEEEcccccccccccEEEEEEccHHHHHHHHHcccccccccCEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEccHHHHHHHHHcccccccccc
******T****PPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIA***************************************DNMRNNSRGGGASSGGGFNDFSRG**********************GLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YGRNQKTLPTEPPYTAFVGNLPNGITQGDVERFFPEQKLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGLQVRLDIADGKRNDNKGGFNNKQNRGGGSGGMGGNKYNQHQGGSFNRDNMRNNSRGGGASSGGGFNDFSRGGEGPGGFRNNNGPNRSNSMNDHGLMVTEVTTLVSVRLVKDKETDRFKGFCYVEFVDVENLRQALLKDGRITVDGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 4H Stimulates the RNA helicase activity of EIF4A in the translation initiation complex. Binds weakly mRNA.confidentQ5XI72
Eukaryotic translation initiation factor 4H Stimulates the RNA helicase activity of EIF4A in the translation initiation complex. Binds weakly mRNA.confidentQ1JPH6
Eukaryotic translation initiation factor 4H Stimulates the RNA helicase activity of EIF4A in the translation initiation complex. Binds weakly mRNA.confidentQ5RBR8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0006417 [BP]regulation of translationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 13-97,153-227
View the alignment between query and template
View the model in PyMOL
Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 13-101,116-131,145-227
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain A
Confidence level:confident
Coverage over the Query: 9-101
View the alignment between query and template
View the model in PyMOL